SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161527903|ref|YP_001581729.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527903|ref|YP_001581729.1|
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily Prefoldin 1.19e-20
Family Prefoldin 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527903|ref|YP_001581729.1|
Sequence length 145
Comment prefoldin subunit alpha [Nitrosopumilus maritimus SCM1]
Sequence
MSQEQAEQLMQQMQMLETYFADLSQRENTFLGVFREATAAIESIKSLSKNPESDTLVPIG
LGTYVPTKISSDSKIILNIGAGVAVEKDFPSAINYLEERIKEIEIAIQDTAAKKQDAAQR
LEQGKAQVNQLMQAMQQSGQPPKSG
Download sequence
Identical sequences A9A592
gi|161527903|ref|YP_001581729.1| 436308.Nmar_0395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]