SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161527907|ref|YP_001581733.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527907|ref|YP_001581733.1|
Domain Number 1 Region: 83-152
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.51e-17
Family Ribosomal S5 protein, N-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 165-236
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-16
Family Translational machinery components 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161527907|ref|YP_001581733.1|
Sequence length 238
Comment 30S ribosomal protein S5 [Nitrosopumilus maritimus SCM1]
Sequence
MSQTTESKPQGGQKGKGAPTYGGGRPDGAKGGDRPRRRREPEEEVWVPKTILGQKVASGE
ISSLEEIIELGLRIQEAGIIKKLLPDLKSEVVDVGIIQKMTSNGQSTRFKAIVATGNENG
YLGIGQGKSKQMRIAIEKATNAAYLNVNPIKMGCGSWECRCDQKHSVPFKVKGKGGSVTI
EIIPAPRGLGLVAGGKIKRLLELAGLKDAWTTAKGSTPTMNSTSKAILDCLRQTFSQG
Download sequence
Identical sequences A9A596
436308.Nmar_0399 gi|161527907|ref|YP_001581733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]