SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161527933|ref|YP_001581759.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527933|ref|YP_001581759.1|
Domain Number 1 Region: 8-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-32
Family Translational machinery components 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161527933|ref|YP_001581759.1|
Sequence length 149
Comment 30S ribosomal protein S9 [Nitrosopumilus maritimus SCM1]
Sequence
MTTPKTEIYFATRKTSSAHVYITKGQGKVRINNVPVEMIPQETAREVILAPLEITGDLRD
KIDISVRVRGGGFMGQASAVATAISRALTGWTKSKKDPKDHPFPKSTREDLRKRITDYDK
YLISGDARRKEPKKFGGPGARRRKQKSYR
Download sequence
Identical sequences A0A081RKW7 A0A087RU99 A0A087S0A1 A0A087S815 A0A0C5CD61 A9A5C2
gi|161527933|ref|YP_001581759.1| 436308.Nmar_0425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]