SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161527940|ref|YP_001581766.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527940|ref|YP_001581766.1|
Domain Number 1 Region: 10-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-45
Family Ribonuclease PH domain 1-like 0.00000578
Further Details:      
 
Domain Number 2 Region: 155-239
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.83e-24
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527940|ref|YP_001581766.1|
Sequence length 244
Comment exosome complex exonuclease 1 [Nitrosopumilus maritimus SCM1]
Sequence
MGGREATMVLMDENGKRCDGRTVDEPRRIMIKAGGLKNADGSSYIEFGDNKILVGVFGPR
DVHPKHMSDTDTGILRVRYHMEPFSVGERKNPAPSRREIEISKVIKEALEPAVMLEKFPR
TAVDVFIEVLQADGGTRCAALTAASVALADAGIPMRDMVAAIAAGKVADTVILDVNNEED
QAGQADMPIGYMPNLEKITLLQLDGVLTPEEYKKCIQVGVDGCKLVYELQKKALNDKYFG
NKGD
Download sequence
Identical sequences A9A5C9
gi|161527940|ref|YP_001581766.1| 436308.Nmar_0432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]