SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528200|ref|YP_001582026.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528200|ref|YP_001582026.1|
Domain Number 1 Region: 2-194,363-447
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.63e-54
Family Bacterial dinuclear zinc exopeptidases 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|161528200|ref|YP_001582026.1|
Domain Number - Region: 255-349
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0136
Family Bacterial exopeptidase dimerisation domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161528200|ref|YP_001582026.1|
Sequence length 450
Comment peptidase M20 [Nitrosopumilus maritimus SCM1]
Sequence
MNPLKHVDDHMEDLISDLQTLIRQPSVSAKNEGIEECAKLVQKLLKKSGVKSEILRLKKG
VAPIVYGEVKSKQNPNKTLMFYNHYDVQPAEPFDLWDSPPFSGTRKGNKIFGRGATDDKG
ELITRIKAVDACLKATGDVPCNIKFVIEGEEETGSANIEDYLKKYKKKFSCDGVIWEFGY
VDAKNRPIIGLGMKGLLFVELSVKESTRDAHSSLAVLIKNPAWRLIEAVHSLRDSNGKIL
IKDWYKEVTPLSKQDLKLIQSEPFDENDFKKEFGIKSFVGNKKGLDAKKALVGGATCNIA
GFVSGYTGDGAKTVLPSESLVKIDFRLVPKMDPKKQVMRLKRHLKSKGFSDIGIKVFHGE
AAARTNSSNPFVSQVKDAADKSFGTSILNVSNAGTGPMYPFVEILKAPCIAIGSTYMFSR
IHSPNEFARVDLLKKMTKCACLIMDNFGKS
Download sequence
Identical sequences A9A499
gi|161528200|ref|YP_001582026.1| 436308.Nmar_0692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]