SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528256|ref|YP_001582082.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528256|ref|YP_001582082.1|
Domain Number 1 Region: 9-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-65
Family G proteins 0.00000927
Further Details:      
 
Domain Number 2 Region: 462-617
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.8e-39
Family Translational machinery components 0.0000986
Further Details:      
 
Domain Number 3 Region: 258-380
Classification Level Classification E-value
Superfamily Translation proteins 1.87e-27
Family Elongation factors 0.0021
Further Details:      
 
Domain Number 4 Region: 387-462
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.35e-20
Family EF-G/eEF-2 domains III and V 0.00048
Further Details:      
 
Domain Number 5 Region: 622-715
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.22e-19
Family EF-G/eEF-2 domains III and V 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528256|ref|YP_001582082.1|
Sequence length 730
Comment elongation factor EF-2 [Nitrosopumilus maritimus SCM1]
Sequence
MVKFKSTSDVMKIIKNKDQIRNFGVIAHVDHGKTTMSDSLLAYSGIIAPSAAGKALAMDF
DKEEQQRGITIYQANVTLLFQQKDKEYVINMIDTPGHVDFSGRVIRSLRAIDGAVVVCDA
VEGIMTQTETVTRMALEERVKPVLFINKVDRLIKELRLTPEKMQAQLAEVVSNFNQLIDT
YAEPEYKEKWKVSIQDASVTFGSAKDRWAINVDLMKERGITFKDVIDAYENEKVADLVEK
APLADAVLGMVVKHHPAPAEAVKYRIPQIWKGDLDSDVGKALLSCSDDGPTIMMIVNMVL
DPAAGPVAIGRLFSGTIKDGQTIQIIDEKREGRVQSVNFFMGNQREQVGELGAGNIPALL
GLTEARAGNTLSTVKDIPMFEGVKYVSEPVVQVAIEPKHPKDLPKLVEVLKQLTIEDPNL
VVKIDEESGETIVAGMGVLHLDVATHRIQDAKVEIVTSEPLINYRETVKAGCEPIMAKSP
NRHNKIFMKVEPLEPEIATMLRTGEISDMKDKKVVSDLLKGAGWDTDTIKRVMKFDSRGN
VLINGTKGVQFVQESTDSINSGFDEVMKEGPLCKEQMRDCKFTFTHFVPHEDTAHRGLSQ
LGPASRRACMGALLTAGTAVLEPTLAIEVRVPTDLVGNVATVLSGKRGKVLDMAQKGASS
IVTGEIPASETFTLSEEMRGQTAGRATWNTSFKAWTEVPKSMLSAAVSDIRKRKGLAPDP
PGANEFIDKE
Download sequence
Identical sequences A9A4F5
436308.Nmar_0748 gi|161528256|ref|YP_001582082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]