SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528304|ref|YP_001582130.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|161528304|ref|YP_001582130.1|
Domain Number - Region: 8-47
Classification Level Classification E-value
Superfamily RING/U-box 0.00152
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528304|ref|YP_001582130.1|
Sequence length 59
Comment 30S ribosomal protein S14 [Nitrosopumilus maritimus SCM1]
Sequence
MAKDRSYEFTGRKKHDFGRGSRWCKRCGDYTAVIQKYDLMICRRCFREVATSLGFRKNR
Download sequence
Identical sequences A0A2H9MR95 A9A5I1
gi|161528304|ref|YP_001582130.1| 436308.Nmar_0796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]