SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528516|ref|YP_001582342.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528516|ref|YP_001582342.1|
Domain Number 1 Region: 138-340
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.33e-40
Family ATP-binding domain of peptide synthetases 0.0013
Further Details:      
 
Domain Number 2 Region: 374-557,667-739
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-25
Family Bacterial dinuclear zinc exopeptidases 0.0019
Further Details:      
 
Domain Number 3 Region: 38-138
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.00000000199
Family D-Alanine ligase N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528516|ref|YP_001582342.1|
Sequence length 743
Comment D-alanine--D-alanine ligase [Nitrosopumilus maritimus SCM1]
Sequence
MDSQIPTKLKLNTIKKYCEYLMKVSLIYNEKKIDPNDVINVFGMTTKEHYSSKAVERVAR
ALEKGGHSVKVIEGDIHLADELREFMPKVVSGEKPGMVFNMAYGIQGQNRYTHVPAMMEM
LGIPYIGSGPAGHAIVQDKVMTKIVLQKNNIPTPGFWVFKTPDDKFDDLVFPVIVKPKLE
STSMGMEVVDNWDDLRNAVKVQIEKYQQDILVEQFISGREFAVGLIGNSPNIEVLPIVEI
NLGDPDKIQTISDKKKTGGVDKTCPAKLSKEKTEYMKKICIDAFTALGLNDYTRVDFRMD
KDENIYILELNSMASLGMGGSLFYAAKTAGYTYESLINKILDVATMRYFGSSQLPETEHE
PDLTQPLRIVARTYLRSHLQNQKDTLKDFVNLNTHVHNIDNVNKLGTMLSRRMKHLGFSE
HLHRQFEIGDFHYFKNHEDEKNDVLIISHMDTHYGPNDLISYFEDDDRIYGSGIAESKGG
LTVMLGALHALRFAKRLKKIKCGVLLTTDDSLGGRFSKKLVQQYSKKSKYVIGLKSASKD
GGIITTCYGRNDYQIRFTTPNSTSSDIHGIIPILGKKITAIEKLSKDEKNYRLRTTSVIA
QGTHGHAPNYATLSIVCSFKTPALGKTMDSKIRTIMQKKESGQKNLEVAINQIQTRPPVI
EEESDKKFYEQVEDLAKKHELKIRRHEQIMSSDISNVPSRLPALDGFGPVGHKYRSTQEY
ILHDSITERSALLASVLYRCSGN
Download sequence
Identical sequences A9A3H2
gi|161528516|ref|YP_001582342.1| 436308.Nmar_1008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]