SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528602|ref|YP_001582428.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528602|ref|YP_001582428.1|
Domain Number 1 Region: 11-105
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000000000281
Family PNP-oxidase like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528602|ref|YP_001582428.1|
Sequence length 130
Comment pyridoxamine 5'-phosphate oxidase family protein [Nitrosopumilus maritimus SCM1]
Sequence
MHPKIEAKLKYLEEIESEKYISVETYRKNGDPVKTPVWFTIKNGLIFVVTRDQTGKVKRL
KNNTQVKIATCTIKGEIKGKWVSGVAEILDEEKTKDAVKRRDKKYGFFSKMARFLTKSKG
ELLAFSIKLK
Download sequence
Identical sequences A9A4L2
436308.Nmar_1094 gi|161528602|ref|YP_001582428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]