SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528758|ref|YP_001582584.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528758|ref|YP_001582584.1|
Domain Number 1 Region: 159-239
Classification Level Classification E-value
Superfamily Cupredoxins 1.7e-21
Family Plastocyanin/azurin-like 0.004
Further Details:      
 
Domain Number 2 Region: 39-76
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000471
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528758|ref|YP_001582584.1|
Sequence length 239
Comment protease inhibitor Kazal-type [Nitrosopumilus maritimus SCM1]
Sequence
MNFSYGIIAAVGILVAISVGLISMSPDEIIEPRTVEEQPIACTMQWDPMCGVDGETYGNS
CMLDAANVKLDYVGECVIAEPEPEPIPEPEPEPEPIPEPEPEPEPIPEPEPEPEPIPEPE
PEPEPIPEPEPEPETQSDLPMSLTISAPEGSGVPGCEETNECYLPYEATVAVGTTVTWSN
DDTAAHTVTSGNVSAGPTGVFDSGLFMSGGTFEFTFEETGTYDYFCMVHPWMTGIIHVE
Download sequence
Identical sequences A9A1G7
436308.Nmar_1250 gi|161528758|ref|YP_001582584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]