SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528804|ref|YP_001582630.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528804|ref|YP_001582630.1|
Domain Number 1 Region: 13-162,283-366
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-47
Family Bacterial dinuclear zinc exopeptidases 0.0021
Further Details:      
 
Domain Number 2 Region: 176-275
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000000000419
Family Bacterial exopeptidase dimerisation domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528804|ref|YP_001582630.1|
Sequence length 375
Comment N-acetyl-ornithine/N-acetyl-lysine deacetylase [Nitrosopumilus maritimus SCM1]
Sequence
MDTHFTVTPRFATKMLEKALRLYTPSLSEKPMAEFLADKCDDLGFEDIQIDEVGNVIAKK
GSGTPKIMLCGHMDVVPGKVKVRKEGDSLYGRGASDAKAPLMAMLFAAASIQNNNGTIIF
VGAVDEEGNATGIKNLVKKEMGVDYAVFGEPSGIKQVTIAYKGRLAINLKVTVEDSSHAS
APWLSKNAILESMIFARELKEKLEENQEDRTKGMLLTATMTEVKGGTSHNVTPKECETTF
DIRIPVDMNCKSVEQKIANLVKEISKKREVEAFYSILDETEPFEAAHNSPLVRAFTLGVM
DVEHTRPKLIRKTGTGDMNVLGTQWSIPVVTYGPGDPHEAHTIDEKVSIDEYLRGIEILK
KMLQHLKRLHDRKMQ
Download sequence
Identical sequences A9A1L3
gi|161528804|ref|YP_001582630.1| 436308.Nmar_1296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]