SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528897|ref|YP_001582723.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528897|ref|YP_001582723.1|
Domain Number 1 Region: 93-249
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-31
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0032
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.68e-18
Family Ferredoxin reductase FAD-binding domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161528897|ref|YP_001582723.1|
Sequence length 270
Comment oxidoreductase FAD/NAD(P)-binding subunit [Nitrosopumilus maritimus SCM1]
Sequence
MQRNHNHTTIVTVEKVIDETPTVRTLVFSDEVMSNVLPGQFAMVWIPGINELPMSVMISD
ESGKAAFTVRKHGAASTGLFNVKVGEQIGIRGPYGNSFDLKEGKLLLVGGGTGLVPMMRL
LTHVKPTDDITVLIGAKSKDEVFFEDLANRLLENNPHKVIVSTDDGSYGEKGFVTDLVEK
HVDQIKFDGVYVCGPEIMMYKTVQSAHSRGIFVQASLERMMKCGVGICGSCCVGEDLVCK
DGTVFDGQHLSQNKEFGKFHRNKAGILENY
Download sequence
Identical sequences A9A3M3
436308.Nmar_1389 gi|161528897|ref|YP_001582723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]