SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528916|ref|YP_001582742.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528916|ref|YP_001582742.1|
Domain Number 1 Region: 414-573
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.6e-48
Family DNA gyrase/MutL, second domain 0.00000574
Further Details:      
 
Domain Number 2 Region: 16-227
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-25
Family DNA gyrase/MutL, N-terminal domain 0.0000401
Further Details:      
 
Domain Number 3 Region: 358-409
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000322
Family Topoisomerase VI-B subunit middle domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528916|ref|YP_001582742.1|
Sequence length 626
Comment DNA topoisomerase VI subunit B [Nitrosopumilus maritimus SCM1]
Sequence
MSSIKEKFNQISPSEFFYSNRDLAGFSNPTRSLYTAVREFVENALDACDQKGILPDVHLT
IKAVEPDKPDPKPYILTVKDNGPGVDAKHIPLAFGTVLYGSKFGLKQARGMFGLGATMAI
LYGQITTNKPVIVKSCADGQTQNQFEILLDIQKNKPVIVKHNTKEASKKGLSVSICLEGD
YSKAGNKIRDYVYETSLITPYATITFDDPKGQKFQHTRFVKEIPPPPTIIRPHPHGIDVE
RIRRMIVESQFEIPTIDDVMIEKVRKDLGLSKQNLSFTAIMTKAKKKWKNLSRQVRVVIA
LLSFLKMDFEKLSKIRIEDLDVPNKKLHYWDFGDSQSKTVDMDPESQYYKQLTNTVQGEP
LTTFLTKRFQRVGPTTAVKFAEFAKFKPEKRMGTLTNQELVNLSDALQKFDDFMAPDSSC
LAPLGESPLEKGIKKFFNPDFVAVVQRPASAYSGFPFIVEMGIAYGGDIKSGGPHVYRYA
NRIPLLYDEGSDVVLKVVNDTDWGRYKVKGDPPFIIVSHICSTRIPYKTAGKENVADRQE
IERELRLGLQFLSRKLAAFMSKRGQAEMAKKRANLYAKYIPMIAEFCTELAGKKKEPNYK
KILEELEPVEIKTEKTIEEEKPIESK
Download sequence
Identical sequences A9A3P2
436308.Nmar_1408 gi|161528916|ref|YP_001582742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]