SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528989|ref|YP_001582815.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528989|ref|YP_001582815.1|
Domain Number 1 Region: 129-278
Classification Level Classification E-value
Superfamily CBS-domain pair 4.03e-24
Family CBS-domain pair 0.0013
Further Details:      
 
Domain Number 2 Region: 9-129
Classification Level Classification E-value
Superfamily CBS-domain pair 1.2e-23
Family CBS-domain pair 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528989|ref|YP_001582815.1|
Sequence length 282
Comment signal transduction protein [Nitrosopumilus maritimus SCM1]
Sequence
MKHASDYKHAPRTMKLESTLADALKKILDEKKSRILVTENDKVTGIVTEKDLGIFLLTDD
TERNLSDIPLSTIVQKIISVDEHTSMIECAEIMLTKSIGSLVITSNDEVVGIITKTDLVR
YFTKMHPDEKLVGEYMSPYYAWQYSDTPLYKIVLKMIDEKISRIIIRNRKDVPVGIITFR
DLFALALKQGNFEDVLDNTDPVISVIFPRKGFISESGFGASVNVEDIMSKDIVSVNYDDD
LANTGNLLLEKNINGVGVLSQHGNIVGILSKTDIVKAIAFLK
Download sequence
Identical sequences A9A4S3
436308.Nmar_1481 gi|161528989|ref|YP_001582815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]