SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161529063|ref|YP_001582889.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529063|ref|YP_001582889.1|
Domain Number 1 Region: 89-179
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-25
Family Imidazole glycerol phosphate dehydratase 0.00059
Further Details:      
 
Domain Number 2 Region: 4-86
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.15e-23
Family Imidazole glycerol phosphate dehydratase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529063|ref|YP_001582889.1|
Sequence length 195
Comment imidazoleglycerol-phosphate dehydratase [Nitrosopumilus maritimus SCM1]
Sequence
MKKRSSKIKRETKETDVSVNVNIDGTGKTSVSTGVNFVDHLIAAFGKHAMLDLTVKAKSK
DNIVHHLIEDTAITIGNAIDDALGNRSGVTRFSYASVPMDESLAEASVDLVKRPFYKLTL
SIKRTKIEDVSKEDLEHFFQSLLQNLNSCIHLTVKYGDNDHHKVEAAMKSLAVAFRIACS
KDSKQKGIPSTKGAM
Download sequence
Identical sequences A9A5X3
436308.Nmar_1555 gi|161529063|ref|YP_001582889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]