SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161529149|ref|YP_001582975.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529149|ref|YP_001582975.1|
Domain Number 1 Region: 87-275
Classification Level Classification E-value
Superfamily vWA-like 2.82e-31
Family Integrin A (or I) domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161529149|ref|YP_001582975.1|
Sequence length 316
Comment von Willebrand factor type A [Nitrosopumilus maritimus SCM1]
Sequence
MEIHFEYLYALFLLLIIPGLYVLYSKYNSEKKDSIMKFSSLKIVKKSVMGKNFLRKHLPF
VLMMGILGLAIIGLANPQIPTLSVENGINLSIVLDGSESMAATDYEPTRLDAAKNAINNL
ILKMGPQHNVGVVLFESGATTVSYLTPDKEKSVNAISSIEQGLGATAIGDGLALGVDMAS
SIPDKKGVVILLSDGVHNSGLVTPEEATEYAKINNVQIHTIGLGSIEPVFLRDDIYGEPQ
YAELDEETLVIIAQQTSGNYYKSLDEQTLNEIFVNLSSNLAYEIEYSTIRDWFIAAAIGL
LLIDAYIIYGRYRIVA
Download sequence
Identical sequences A9A1M2
436308.Nmar_1641 gi|161529149|ref|YP_001582975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]