SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161529150|ref|YP_001582976.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529150|ref|YP_001582976.1|
Domain Number 1 Region: 73-209
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000534
Family Integrin A (or I) domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161529150|ref|YP_001582976.1|
Sequence length 290
Comment hypothetical protein Nmar_1642 [Nitrosopumilus maritimus SCM1]
Sequence
MTELTELLKQVKNLDIKTKNLVEGMESGAYRSRFRGGGIEFSEVREYAAGDDARRVDWNV
SARYNDLFVKEFVEEKELNVYVVMDMSASNDFGFVKSKKELGFEITASLMFSALKNNDRV
GLGLFTDSLEKFVPAKKGKKHMMEILKKLLEYTPQSTQTDIFRSLSELQKNLKRRSVVFV
VSDFMSDSFVKPLQYLKLKHQIVLVNISDIRETEIPEIGHVYLEDAESGEQILVNTSDKK
FQEEYSNLIKKTREEIEYEMKKLGVDFLNLSNEEPFDVTFNRYIHTRRRK
Download sequence
Identical sequences A9A1M3
gi|161529150|ref|YP_001582976.1| 436308.Nmar_1642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]