SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161529291|ref|YP_001583117.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529291|ref|YP_001583117.1|
Domain Number 1 Region: 56-197
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000208
Family Protein kinases, catalytic subunit 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529291|ref|YP_001583117.1|
Sequence length 253
Comment serine/threonine protein kinase [Nitrosopumilus maritimus SCM1]
Sequence
MAHSFISIKKFVDEPYSEILGYPKSTPRQTKSRINELDKLKIKSISLTGPTTLGKLEILG
KGYVGVVVLAKKGSREVALKIRRIDSQRKEMKSEAKLLKLVNSVNVGPKMIDVSKNFLVM
EYIEGIKIVDWVNSLKGVGSVKKLKSTIRKVLEDCYNLDQIGFDHGELSNISKHVIVGKT
KSTLIDFESSSVKRRPSNVTSVTQAIFIGSGIAKKVQKIYKNPPKEKIIGALKQYKQEKS
LENFENLLKILKL
Download sequence
Identical sequences A9A3X9
436308.Nmar_1783 gi|161529291|ref|YP_001583117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]