SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528866|ref|YP_001582692.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528866|ref|YP_001582692.1|
Domain Number 1 Region: 207-432
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.55e-37
Family Zn metallo-beta-lactamase 0.026
Further Details:      
 
Domain Number 2 Region: 150-192
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000541
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528866|ref|YP_001582692.1|
Sequence length 479
Comment beta-lactamase domain-containing protein [Nitrosopumilus maritimus SCM1]
Sequence
MQDTAVAKNNKRYDKFQKYMKNNFLVFSFSLFSLVAVLAVSLVSYSYADDVRIHEKHIPY
NNVCAPGFASLGDLCVLNDRCGPSVYAGKVCVMDGVKQPYLRPTQQGNAGIAASDVICAE
GLNLIFKSRDASPACVTPDSADKLEQRGWQTQYPVIACTLEYAPVCGIDGKTYGNKCAID
SSHVAVKHAGECSDVIPTEFELDETVLQHTLVPIQTDPDKGYAVLEIADGVYWLVGSGYQ
TMFLTTGQGVVAVDAPQPIGEKYLSAIDEVTDEPITHMIYSHHHQDHTGAAGEIFSQDIT
YISHKDAADELKSENNPDRPIPTQILEGDFNTLEIGNKTIEFYNLGDFHSKGNLLILLPN
YKVAMLVDLLRPAESPYRAFGVTPDIDLYLDTHDTLQNYDFEVLISGHTNLLATKDHIKT
NKQFTQSVMDNAQLGLDSVDSEALDVCTTLTIEQWEGKLGNLDAFMDDHCNAMIEYLTQ
Download sequence
Identical sequences A9A2L5
gi|161528866|ref|YP_001582692.1| 436308.Nmar_1358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]