SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157693540|ref|YP_001488002.1| from Bacillus pumilus SAFR-032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157693540|ref|YP_001488002.1|
Domain Number 1 Region: 323-357,390-659
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.45e-76
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000984
Further Details:      
 
Domain Number 2 Region: 87-193
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000392
Family Sensory domain of two-component sensor kinase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157693540|ref|YP_001488002.1|
Sequence length 662
Comment sensor histidine kinase [Bacillus pumilus SAFR-032]
Sequence
MKFIQYFRKPSISKKLVLSFLFILLCPIIVLAFSSYHTASTSLNDQIMQSAKENVEQLDK
NITKVVKVKTDAADFFSKWITEKKLKQKGTTDIQGRFEQFMSMNDDTEGIFVASSDGKVF
SRYPNKKMPADYVATERDWYKDGWAKNGELSVSAPYPTASTGTLVVTISKKLEDGSGVIA
MNLDIANLVKESNSINIGKQGYAFIGSPDRTFVAHPTKKAGTKLSGEWLEKLYSQDEGSM
SYMFEGKEKQMEFTTNKATGWKIVGTMFVTEVEEAAQPVFNMAAIILAGALIIGGILIFL
IIRSITKPLSILVSSSKKISEGDLTEKIDVQSKDEIGQLGTSFNEMSESLRDVIQAVQTS
VENVASSSEELTASAGQTTKATEHITSSIETFSNGNENQSEMVEQSAAHLKQMNEGLNEV
AETSDVITASSIQSRTVAESGGQLVEQTVGQMKTIDHSVKEAEGVINGLEHKSKDITNIL
GVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSSDSAKEIEKLVKEIV
SEIETSQNMFKSVNEEVKNGLSITDQTKESFSQINQQTAEIATRINDMNTTVRELSKGSE
QISKAVNEIADVSRESSASIQDIAASAEEQLASMEEISSSSTTLSQMAEELRDLIKKFKI
NE
Download sequence
Identical sequences A8FGS5
315750.BPUM_2787 gi|157693540|ref|YP_001488002.1| WP_012011065.1.28396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]