SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157826859|ref|YP_001495923.1| from Rickettsia bellii OSU 85-389

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157826859|ref|YP_001495923.1|
Domain Number 1 Region: 203-356
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 1.96e-74
Family RalF, C-terminal domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 7-199
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-53
Family Sec7 domain 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157826859|ref|YP_001495923.1|
Sequence length 658
Comment Sec7 domain-containing protein [Rickettsia bellii OSU 85-389]
Sequence
MDPLIKREVISSFNDKPKDGINKIKEWCASNNKDFAEETAKFFREEKNNLDLVAVGDYLG
TDGEDNKKVLDHFVKQFDFKDKNYLKSLREFLKAFKLPGEAQKIDRLVESFASKYYEQNT
TTDINHADAAFISAYATVGLNTNLHNPSVKDKWTIDQFKDQLKGLNAESKLQGIKSGKNF
SNEFLENIYNGIKAEPFELNFIQTATGYEIAGISSQNDKTFKKLDDFLTAKTDINNVFSN
LGNNVTAQHKQPKTWLNKFTGYEGSVSVKAGNAEVEIQVYKPNILSKWFLGEKSKLVIQP
KGGSEQSLKLAAQIAASFETKVTSIKATYDYLKQDLENYYNNPEQELRKANLVVDLHNKI
KETTAKVQQADPEIPDTKSIPLASETNFQDLKEAEVGIQPAKTQPVEKPKFNTLVEELAW
RNAQKKQAIDTPVTKNEEPKAQIDNHKKRLEELKQKQEDLENKKKELEEKKANSNITKEE
KWRIVAELEGVTKHLESIKKEHNTINTAEEREKQFNKSSQSSALKGEPTAADKQQQAAME
LIRLRKQRLQEEAASKAIIANNPATQPLKPGVIPPPPPPPPGKGVPIPPPPPPPMPGQGV
PIPPPPPPPPPPMPAIPPKLQETLKTIQTTQDGNKQQGNNNFQDDLRKTLARRNSPTR
Download sequence
Identical sequences WP_012151718.1.88888 gi|157826859|ref|YP_001495923.1| 391896.A1I_02560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]