SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159903016|ref|YP_001550360.1| from Prochlorococcus marinus str. MIT 9211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159903016|ref|YP_001550360.1|
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000933
Family Tudor domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159903016|ref|YP_001550360.1|
Sequence length 84
Comment hypothetical protein P9211_04751 [Prochlorococcus marinus str. MIT 9211]
Sequence
MSGVQVLHGAFDHPYSSFLVLRMELDLQPGDVVKVLESAALGWVRARVIRVKSGGRVVVQ
SDQGREFTARGNQVRLIEPAGFRP
Download sequence
Identical sequences A9BE96
gi|159903016|ref|YP_001550360.1| 93059.P9211_04751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]