SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162418153|ref|YP_001607798.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162418153|ref|YP_001607798.1|
Domain Number 1 Region: 25-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.18e-37
Family Thioltransferase 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|162418153|ref|YP_001607798.1|
Domain Number - Region: 4-33
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0418
Family RBP12 subunit of RNA polymerase II 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162418153|ref|YP_001607798.1|
Sequence length 145
Comment thioredoxin 2 [Yersinia pestis Angola]
Sequence
MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFW
APWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMID
MLNGAVPKAPFDNWLDEQLSRDPNS
Download sequence
Identical sequences A0A0E1NQR7 A0A0H2YEU8 A0A0H3B759 A0A0U1EPF5 A0A208S4S0 Q0WC18 Q7CK81
gi|45440512|ref|NP_992051.1| gi|294504984|ref|YP_003569046.1| gi|218930295|ref|YP_002348170.1| gi|170025558|ref|YP_001722063.1| gi|108810991|ref|YP_646758.1| gi|22124827|ref|NP_668250.1| gi|384415956|ref|YP_005625318.1| IDP04482 WP_002216643.1.100083 WP_002216643.1.100246 WP_002216643.1.100593 WP_002216643.1.100921 WP_002216643.1.100931 WP_002216643.1.10105 WP_002216643.1.101305 WP_002216643.1.101382 WP_002216643.1.101928 WP_002216643.1.102012 WP_002216643.1.102067 WP_002216643.1.10736 WP_002216643.1.10935 WP_002216643.1.10955 WP_002216643.1.11693 WP_002216643.1.12463 WP_002216643.1.12736 WP_002216643.1.12857 WP_002216643.1.1388 WP_002216643.1.14063 WP_002216643.1.14804 WP_002216643.1.15321 WP_002216643.1.15555 WP_002216643.1.15605 WP_002216643.1.15689 WP_002216643.1.16243 WP_002216643.1.16333 WP_002216643.1.17135 WP_002216643.1.17141 WP_002216643.1.17608 WP_002216643.1.17873 WP_002216643.1.17983 WP_002216643.1.18208 WP_002216643.1.18640 WP_002216643.1.18826 WP_002216643.1.19329 WP_002216643.1.19425 WP_002216643.1.19739 WP_002216643.1.19763 WP_002216643.1.20035 WP_002216643.1.20380 WP_002216643.1.2064 WP_002216643.1.20932 WP_002216643.1.21486 WP_002216643.1.21784 WP_002216643.1.21934 WP_002216643.1.22530 WP_002216643.1.22542 WP_002216643.1.22708 WP_002216643.1.23157 WP_002216643.1.23271 WP_002216643.1.23687 WP_002216643.1.23811 WP_002216643.1.24002 WP_002216643.1.2451 WP_002216643.1.25181 WP_002216643.1.25394 WP_002216643.1.2640 WP_002216643.1.26776 WP_002216643.1.26960 WP_002216643.1.27124 WP_002216643.1.27251 WP_002216643.1.2726 WP_002216643.1.28647 WP_002216643.1.28922 WP_002216643.1.29157 WP_002216643.1.29186 WP_002216643.1.29355 WP_002216643.1.2947 WP_002216643.1.29622 WP_002216643.1.2964 WP_002216643.1.29685 WP_002216643.1.29814 WP_002216643.1.3092 WP_002216643.1.30931 WP_002216643.1.311 WP_002216643.1.31336 WP_002216643.1.31496 WP_002216643.1.31721 WP_002216643.1.31739 WP_002216643.1.31805 WP_002216643.1.32343 WP_002216643.1.32388 WP_002216643.1.32446 WP_002216643.1.32736 WP_002216643.1.33203 WP_002216643.1.33324 WP_002216643.1.33661 WP_002216643.1.33775 WP_002216643.1.33937 WP_002216643.1.34031 WP_002216643.1.34138 WP_002216643.1.35389 WP_002216643.1.35538 WP_002216643.1.36088 WP_002216643.1.37174 WP_002216643.1.37494 WP_002216643.1.37863 WP_002216643.1.38147 WP_002216643.1.38235 WP_002216643.1.38532 WP_002216643.1.38743 WP_002216643.1.38824 WP_002216643.1.38993 WP_002216643.1.39066 WP_002216643.1.39346 WP_002216643.1.3976 WP_002216643.1.39858 WP_002216643.1.40071 WP_002216643.1.40134 WP_002216643.1.40534 WP_002216643.1.40853 WP_002216643.1.41196 WP_002216643.1.41984 WP_002216643.1.4210 WP_002216643.1.42361 WP_002216643.1.42490 WP_002216643.1.44408 WP_002216643.1.44598 WP_002216643.1.44603 WP_002216643.1.44832 WP_002216643.1.45198 WP_002216643.1.45214 WP_002216643.1.46262 WP_002216643.1.46545 WP_002216643.1.46686 WP_002216643.1.46697 WP_002216643.1.46731 WP_002216643.1.4678 WP_002216643.1.46891 WP_002216643.1.47387 WP_002216643.1.47440 WP_002216643.1.48166 WP_002216643.1.48722 WP_002216643.1.4889 WP_002216643.1.49906 WP_002216643.1.4997 WP_002216643.1.50010 WP_002216643.1.50093 WP_002216643.1.50106 WP_002216643.1.50984 WP_002216643.1.51284 WP_002216643.1.51293 WP_002216643.1.51588 WP_002216643.1.51772 WP_002216643.1.51934 WP_002216643.1.52158 WP_002216643.1.52247 WP_002216643.1.52734 WP_002216643.1.52792 WP_002216643.1.52819 WP_002216643.1.52969 WP_002216643.1.53300 WP_002216643.1.53838 WP_002216643.1.53848 WP_002216643.1.53883 WP_002216643.1.53953 WP_002216643.1.54568 WP_002216643.1.54951 WP_002216643.1.55194 WP_002216643.1.55695 WP_002216643.1.5592 WP_002216643.1.56031 WP_002216643.1.56912 WP_002216643.1.56953 WP_002216643.1.57585 WP_002216643.1.57657 WP_002216643.1.58067 WP_002216643.1.58794 WP_002216643.1.59102 WP_002216643.1.59431 WP_002216643.1.5957 WP_002216643.1.59635 WP_002216643.1.5968 WP_002216643.1.59687 WP_002216643.1.59789 WP_002216643.1.59885 WP_002216643.1.60437 WP_002216643.1.60707 WP_002216643.1.60896 WP_002216643.1.61689 WP_002216643.1.62232 WP_002216643.1.62342 WP_002216643.1.6270 WP_002216643.1.63387 WP_002216643.1.63641 WP_002216643.1.64142 WP_002216643.1.64474 WP_002216643.1.64780 WP_002216643.1.64786 WP_002216643.1.64910 WP_002216643.1.653 WP_002216643.1.65400 WP_002216643.1.65554 WP_002216643.1.6570 WP_002216643.1.65706 WP_002216643.1.65718 WP_002216643.1.6581 WP_002216643.1.66118 WP_002216643.1.66546 WP_002216643.1.66616 WP_002216643.1.67404 WP_002216643.1.67850 WP_002216643.1.6791 WP_002216643.1.68361 WP_002216643.1.68371 WP_002216643.1.68753 WP_002216643.1.68855 WP_002216643.1.69018 WP_002216643.1.69316 WP_002216643.1.69951 WP_002216643.1.70117 WP_002216643.1.70171 WP_002216643.1.70319 WP_002216643.1.70377 WP_002216643.1.70417 WP_002216643.1.70726 WP_002216643.1.7083 WP_002216643.1.7169 WP_002216643.1.71744 WP_002216643.1.72280 WP_002216643.1.72440 WP_002216643.1.72486 WP_002216643.1.7402 WP_002216643.1.74131 WP_002216643.1.74310 WP_002216643.1.74577 WP_002216643.1.74738 WP_002216643.1.75169 WP_002216643.1.75173 WP_002216643.1.7518 WP_002216643.1.75208 WP_002216643.1.75337 WP_002216643.1.75407 WP_002216643.1.75636 WP_002216643.1.75689 WP_002216643.1.75821 WP_002216643.1.76555 WP_002216643.1.76670 WP_002216643.1.77295 WP_002216643.1.77387 WP_002216643.1.77429 WP_002216643.1.77569 WP_002216643.1.77691 WP_002216643.1.78004 WP_002216643.1.7841 WP_002216643.1.78556 WP_002216643.1.79515 WP_002216643.1.79550 WP_002216643.1.79609 WP_002216643.1.79825 WP_002216643.1.79981 WP_002216643.1.8009 WP_002216643.1.80331 WP_002216643.1.81848 WP_002216643.1.81877 WP_002216643.1.8210 WP_002216643.1.82133 WP_002216643.1.82151 WP_002216643.1.82270 WP_002216643.1.82436 WP_002216643.1.82619 WP_002216643.1.8303 WP_002216643.1.83039 WP_002216643.1.83265 WP_002216643.1.8420 WP_002216643.1.84703 WP_002216643.1.84720 WP_002216643.1.85269 WP_002216643.1.85270 WP_002216643.1.8559 WP_002216643.1.85802 WP_002216643.1.86034 WP_002216643.1.86413 WP_002216643.1.87107 WP_002216643.1.8728 WP_002216643.1.87418 WP_002216643.1.8762 WP_002216643.1.87853 WP_002216643.1.87988 WP_002216643.1.88362 WP_002216643.1.88472 WP_002216643.1.89359 WP_002216643.1.8964 WP_002216643.1.90176 WP_002216643.1.9051 WP_002216643.1.90624 WP_002216643.1.91373 WP_002216643.1.91844 WP_002216643.1.92030 WP_002216643.1.92331 WP_002216643.1.92604 WP_002216643.1.927 WP_002216643.1.9311 WP_002216643.1.9320 WP_002216643.1.93623 WP_002216643.1.93928 WP_002216643.1.93933 WP_002216643.1.94052 WP_002216643.1.94201 WP_002216643.1.94545 WP_002216643.1.94683 WP_002216643.1.95746 WP_002216643.1.95981 WP_002216643.1.97245 WP_002216643.1.97375 WP_002216643.1.97448 WP_002216643.1.97791 WP_002216643.1.97864 WP_002216643.1.97872 WP_002216643.1.97894 WP_002216643.1.99109 WP_002216643.1.99383 WP_002216643.1.9941 WP_002216643.1.99416 WP_002216643.1.99788 WP_002216643.1.99882 WP_002216643.1.99972 WP_002216643.1.99990 YP_002348170.1.25044 gi|145600165|ref|YP_001164241.1| gi|384138891|ref|YP_005521593.1| gi|162418153|ref|YP_001607798.1| gi|384127309|ref|YP_005509923.1| 187410.y0919 214092.YPO3270 229193.YP_0661 349746.YpAngola_A3463 360102.YPA_2761 377628.YPN_0826 386656.YPDSF_2906 502800.YPK_3341 502801.YPTS_0895 gi|108808752|ref|YP_652668.1| gi|186894221|ref|YP_001871333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]