SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162418373|ref|YP_001604710.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162418373|ref|YP_001604710.1|
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-29
Family Thioltransferase 0.0000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162418373|ref|YP_001604710.1|
Sequence length 82
Comment glutaredoxin 3 [Yersinia pestis Angola]
Sequence
MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMIARSGRTTVPQIFIDG
QHIGGCDDLHALDARGGLDPLL
Download sequence
Identical sequences A0A0E1NWT5 A0A0H2YM62 A0A0H3B7U6 A0A0M1VCH9 A0A0T9KQE9 A0A0U1EU63 A0A0U1QVW5 A0A208S6G5 Q0WKM8 Q66GC0 Q7CLB8
gi|145601079|ref|YP_001165155.1| gi|218927285|ref|YP_002345160.1| gi|45439930|ref|NP_991469.1| gi|108809467|ref|YP_653383.1| gi|384412914|ref|YP_005622276.1| WP_002208977.1.100083 WP_002208977.1.100246 WP_002208977.1.100593 WP_002208977.1.10066 WP_002208977.1.100921 WP_002208977.1.100931 WP_002208977.1.10105 WP_002208977.1.101305 WP_002208977.1.101382 WP_002208977.1.101928 WP_002208977.1.102012 WP_002208977.1.102067 WP_002208977.1.10736 WP_002208977.1.10935 WP_002208977.1.10955 WP_002208977.1.11693 WP_002208977.1.12167 WP_002208977.1.12463 WP_002208977.1.12736 WP_002208977.1.12857 WP_002208977.1.1388 WP_002208977.1.14063 WP_002208977.1.14169 WP_002208977.1.14804 WP_002208977.1.15321 WP_002208977.1.15555 WP_002208977.1.15605 WP_002208977.1.15689 WP_002208977.1.16243 WP_002208977.1.16333 WP_002208977.1.17135 WP_002208977.1.17141 WP_002208977.1.17608 WP_002208977.1.17873 WP_002208977.1.17983 WP_002208977.1.18208 WP_002208977.1.18640 WP_002208977.1.18826 WP_002208977.1.19425 WP_002208977.1.19739 WP_002208977.1.19763 WP_002208977.1.20035 WP_002208977.1.20380 WP_002208977.1.20547 WP_002208977.1.2064 WP_002208977.1.20932 WP_002208977.1.21486 WP_002208977.1.21784 WP_002208977.1.21879 WP_002208977.1.21934 WP_002208977.1.22530 WP_002208977.1.22542 WP_002208977.1.22708 WP_002208977.1.23157 WP_002208977.1.23271 WP_002208977.1.23687 WP_002208977.1.23811 WP_002208977.1.24002 WP_002208977.1.2451 WP_002208977.1.24517 WP_002208977.1.25181 WP_002208977.1.25394 WP_002208977.1.26383 WP_002208977.1.2640 WP_002208977.1.26509 WP_002208977.1.26776 WP_002208977.1.26960 WP_002208977.1.27124 WP_002208977.1.27251 WP_002208977.1.2726 WP_002208977.1.28647 WP_002208977.1.28922 WP_002208977.1.29157 WP_002208977.1.29186 WP_002208977.1.29355 WP_002208977.1.2947 WP_002208977.1.29622 WP_002208977.1.2964 WP_002208977.1.29685 WP_002208977.1.29814 WP_002208977.1.3092 WP_002208977.1.30931 WP_002208977.1.311 WP_002208977.1.31336 WP_002208977.1.31496 WP_002208977.1.31721 WP_002208977.1.31739 WP_002208977.1.31805 WP_002208977.1.32343 WP_002208977.1.32388 WP_002208977.1.32446 WP_002208977.1.32736 WP_002208977.1.33203 WP_002208977.1.33324 WP_002208977.1.33661 WP_002208977.1.33775 WP_002208977.1.33937 WP_002208977.1.34031 WP_002208977.1.34138 WP_002208977.1.35389 WP_002208977.1.35538 WP_002208977.1.36088 WP_002208977.1.37174 WP_002208977.1.37494 WP_002208977.1.37863 WP_002208977.1.38147 WP_002208977.1.38235 WP_002208977.1.38532 WP_002208977.1.38743 WP_002208977.1.38824 WP_002208977.1.38993 WP_002208977.1.39066 WP_002208977.1.39346 WP_002208977.1.3976 WP_002208977.1.39858 WP_002208977.1.40071 WP_002208977.1.40134 WP_002208977.1.40534 WP_002208977.1.40853 WP_002208977.1.41196 WP_002208977.1.41984 WP_002208977.1.4210 WP_002208977.1.42361 WP_002208977.1.42490 WP_002208977.1.42976 WP_002208977.1.44408 WP_002208977.1.44598 WP_002208977.1.44603 WP_002208977.1.44832 WP_002208977.1.45198 WP_002208977.1.45214 WP_002208977.1.46262 WP_002208977.1.46545 WP_002208977.1.46686 WP_002208977.1.46697 WP_002208977.1.46731 WP_002208977.1.4678 WP_002208977.1.46891 WP_002208977.1.47387 WP_002208977.1.47440 WP_002208977.1.47769 WP_002208977.1.47881 WP_002208977.1.48166 WP_002208977.1.48722 WP_002208977.1.4889 WP_002208977.1.49315 WP_002208977.1.49906 WP_002208977.1.4997 WP_002208977.1.50010 WP_002208977.1.50093 WP_002208977.1.50106 WP_002208977.1.50185 WP_002208977.1.50984 WP_002208977.1.51284 WP_002208977.1.51293 WP_002208977.1.51588 WP_002208977.1.51772 WP_002208977.1.51934 WP_002208977.1.52158 WP_002208977.1.52247 WP_002208977.1.52473 WP_002208977.1.52569 WP_002208977.1.52734 WP_002208977.1.52792 WP_002208977.1.52819 WP_002208977.1.52969 WP_002208977.1.53147 WP_002208977.1.53300 WP_002208977.1.53838 WP_002208977.1.53848 WP_002208977.1.53883 WP_002208977.1.53953 WP_002208977.1.54568 WP_002208977.1.54951 WP_002208977.1.55194 WP_002208977.1.55695 WP_002208977.1.5592 WP_002208977.1.56912 WP_002208977.1.56953 WP_002208977.1.57585 WP_002208977.1.57657 WP_002208977.1.58067 WP_002208977.1.58543 WP_002208977.1.58794 WP_002208977.1.59102 WP_002208977.1.59431 WP_002208977.1.5957 WP_002208977.1.59635 WP_002208977.1.5968 WP_002208977.1.59687 WP_002208977.1.59789 WP_002208977.1.59885 WP_002208977.1.60437 WP_002208977.1.60707 WP_002208977.1.60896 WP_002208977.1.61689 WP_002208977.1.62232 WP_002208977.1.62342 WP_002208977.1.6270 WP_002208977.1.6333 WP_002208977.1.63387 WP_002208977.1.63641 WP_002208977.1.64142 WP_002208977.1.64474 WP_002208977.1.64780 WP_002208977.1.64786 WP_002208977.1.64910 WP_002208977.1.653 WP_002208977.1.65400 WP_002208977.1.65554 WP_002208977.1.6570 WP_002208977.1.65706 WP_002208977.1.65718 WP_002208977.1.6581 WP_002208977.1.66118 WP_002208977.1.66546 WP_002208977.1.66616 WP_002208977.1.67404 WP_002208977.1.67850 WP_002208977.1.68361 WP_002208977.1.68371 WP_002208977.1.68753 WP_002208977.1.68855 WP_002208977.1.69018 WP_002208977.1.69316 WP_002208977.1.69951 WP_002208977.1.70117 WP_002208977.1.70171 WP_002208977.1.70319 WP_002208977.1.70377 WP_002208977.1.70417 WP_002208977.1.70726 WP_002208977.1.7083 WP_002208977.1.7169 WP_002208977.1.71744 WP_002208977.1.72280 WP_002208977.1.72440 WP_002208977.1.72486 WP_002208977.1.7402 WP_002208977.1.74131 WP_002208977.1.74310 WP_002208977.1.74577 WP_002208977.1.74738 WP_002208977.1.75169 WP_002208977.1.75173 WP_002208977.1.7518 WP_002208977.1.75208 WP_002208977.1.75337 WP_002208977.1.75407 WP_002208977.1.75636 WP_002208977.1.75689 WP_002208977.1.75821 WP_002208977.1.76555 WP_002208977.1.76670 WP_002208977.1.77295 WP_002208977.1.77387 WP_002208977.1.77429 WP_002208977.1.77569 WP_002208977.1.77691 WP_002208977.1.78004 WP_002208977.1.7841 WP_002208977.1.78556 WP_002208977.1.7939 WP_002208977.1.79515 WP_002208977.1.79550 WP_002208977.1.79609 WP_002208977.1.79825 WP_002208977.1.79981 WP_002208977.1.8009 WP_002208977.1.80331 WP_002208977.1.81848 WP_002208977.1.81877 WP_002208977.1.8210 WP_002208977.1.82133 WP_002208977.1.82151 WP_002208977.1.82270 WP_002208977.1.82436 WP_002208977.1.82619 WP_002208977.1.8303 WP_002208977.1.83039 WP_002208977.1.83265 WP_002208977.1.8420 WP_002208977.1.84703 WP_002208977.1.84720 WP_002208977.1.85269 WP_002208977.1.85270 WP_002208977.1.8559 WP_002208977.1.85802 WP_002208977.1.86034 WP_002208977.1.86059 WP_002208977.1.86413 WP_002208977.1.87107 WP_002208977.1.8728 WP_002208977.1.87418 WP_002208977.1.8762 WP_002208977.1.87853 WP_002208977.1.87988 WP_002208977.1.88362 WP_002208977.1.88472 WP_002208977.1.89359 WP_002208977.1.89542 WP_002208977.1.8964 WP_002208977.1.90176 WP_002208977.1.9051 WP_002208977.1.90624 WP_002208977.1.91263 WP_002208977.1.91373 WP_002208977.1.91844 WP_002208977.1.92030 WP_002208977.1.92331 WP_002208977.1.92604 WP_002208977.1.927 WP_002208977.1.9311 WP_002208977.1.9320 WP_002208977.1.93623 WP_002208977.1.93928 WP_002208977.1.93933 WP_002208977.1.94052 WP_002208977.1.94201 WP_002208977.1.94545 WP_002208977.1.94683 WP_002208977.1.95746 WP_002208977.1.95981 WP_002208977.1.97245 WP_002208977.1.97375 WP_002208977.1.97448 WP_002208977.1.97791 WP_002208977.1.97864 WP_002208977.1.97872 WP_002208977.1.97894 WP_002208977.1.99109 WP_002208977.1.99383 WP_002208977.1.9941 WP_002208977.1.99416 WP_002208977.1.99788 WP_002208977.1.99882 WP_002208977.1.99972 WP_002208977.1.99990 YP_002345160.1.25044 gi|153947711|ref|YP_001399078.1| gi|384137950|ref|YP_005520652.1| gi|162418373|ref|YP_001604710.1| gi|22123996|ref|NP_667419.1| gi|51594420|ref|YP_068611.1| gi|108813944|ref|YP_649711.1| gi|170026346|ref|YP_001722851.1| 187410.y0075 214092.YPO0066 229193.YP_0066 273123.YPTB0062 349746.YpAngola_A0071 349747.YpsIP31758_0077 360102.YPA_3476 377628.YPN_3784 386656.YPDSF_3839 502800.YPK_4139 502801.YPTS_0064 gi|186893408|ref|YP_001870520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]