SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162418817|ref|YP_001607605.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162418817|ref|YP_001607605.1|
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.1e-28
Family Glutathione peroxidase-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162418817|ref|YP_001607605.1|
Sequence length 211
Comment hypothetical protein YpAngola_A3255 [Yersinia pestis Angola]
Sequence
MPGTTLHYIFDPLCGWCYGAAPLVQTAQNIPGLTLVLHGGGMMSGANRRQIDTQWRSYVM
PHDKRIAELTGQTFGDNYFNQLLNDTSAIMDSTPPIAAILAAEALAGDGAKMLHRIQLAH
YVEGRRIADTPVLTVLAADIGLNTEAFINAFNIAQKHAAQHIAESRTMLAKVQGHGFPTF
ILQDAAGKMTVVPAGDYFGNQPGWINRLTNA
Download sequence
Identical sequences A0A0E1NYE8 A0A0H2W7F4 A0A0H2YLM3 A0A0H3B0I1 A0A0M1V9U2 A0A0U1QZW6 A0A208S7Z1 Q7CGY8
gi|22127065|ref|NP_670488.1| gi|108806465|ref|YP_650381.1| gi|384121454|ref|YP_005504074.1| gi|153949409|ref|YP_001399951.1| gi|218927981|ref|YP_002345856.1| WP_002209852.1.100083 WP_002209852.1.100246 WP_002209852.1.100593 WP_002209852.1.100921 WP_002209852.1.100931 WP_002209852.1.10105 WP_002209852.1.101305 WP_002209852.1.101382 WP_002209852.1.101928 WP_002209852.1.102012 WP_002209852.1.102067 WP_002209852.1.10736 WP_002209852.1.10935 WP_002209852.1.10955 WP_002209852.1.11693 WP_002209852.1.12167 WP_002209852.1.12463 WP_002209852.1.12736 WP_002209852.1.12857 WP_002209852.1.1388 WP_002209852.1.14063 WP_002209852.1.14169 WP_002209852.1.14804 WP_002209852.1.15321 WP_002209852.1.15555 WP_002209852.1.15605 WP_002209852.1.15689 WP_002209852.1.16243 WP_002209852.1.16333 WP_002209852.1.17135 WP_002209852.1.17141 WP_002209852.1.17608 WP_002209852.1.17873 WP_002209852.1.17983 WP_002209852.1.18208 WP_002209852.1.18640 WP_002209852.1.18826 WP_002209852.1.19329 WP_002209852.1.19425 WP_002209852.1.19739 WP_002209852.1.20035 WP_002209852.1.2064 WP_002209852.1.21486 WP_002209852.1.21784 WP_002209852.1.21879 WP_002209852.1.21934 WP_002209852.1.22530 WP_002209852.1.22542 WP_002209852.1.22708 WP_002209852.1.23157 WP_002209852.1.23271 WP_002209852.1.23687 WP_002209852.1.23811 WP_002209852.1.24002 WP_002209852.1.2451 WP_002209852.1.25181 WP_002209852.1.25394 WP_002209852.1.2640 WP_002209852.1.26776 WP_002209852.1.26960 WP_002209852.1.27124 WP_002209852.1.27251 WP_002209852.1.2726 WP_002209852.1.28647 WP_002209852.1.28922 WP_002209852.1.29157 WP_002209852.1.29355 WP_002209852.1.2947 WP_002209852.1.29622 WP_002209852.1.2964 WP_002209852.1.29685 WP_002209852.1.29814 WP_002209852.1.3092 WP_002209852.1.30931 WP_002209852.1.311 WP_002209852.1.31336 WP_002209852.1.31496 WP_002209852.1.31739 WP_002209852.1.31805 WP_002209852.1.32343 WP_002209852.1.32388 WP_002209852.1.32446 WP_002209852.1.33203 WP_002209852.1.33661 WP_002209852.1.33937 WP_002209852.1.34031 WP_002209852.1.34138 WP_002209852.1.35389 WP_002209852.1.35538 WP_002209852.1.36088 WP_002209852.1.37174 WP_002209852.1.37494 WP_002209852.1.37863 WP_002209852.1.38147 WP_002209852.1.38235 WP_002209852.1.38743 WP_002209852.1.38824 WP_002209852.1.38993 WP_002209852.1.39066 WP_002209852.1.39346 WP_002209852.1.3976 WP_002209852.1.40071 WP_002209852.1.40134 WP_002209852.1.40534 WP_002209852.1.40853 WP_002209852.1.41196 WP_002209852.1.41984 WP_002209852.1.4210 WP_002209852.1.42490 WP_002209852.1.44408 WP_002209852.1.44598 WP_002209852.1.44603 WP_002209852.1.44832 WP_002209852.1.45198 WP_002209852.1.45214 WP_002209852.1.46262 WP_002209852.1.46545 WP_002209852.1.46686 WP_002209852.1.46731 WP_002209852.1.4678 WP_002209852.1.46891 WP_002209852.1.47387 WP_002209852.1.47440 WP_002209852.1.47769 WP_002209852.1.48166 WP_002209852.1.48722 WP_002209852.1.49906 WP_002209852.1.4997 WP_002209852.1.50010 WP_002209852.1.50093 WP_002209852.1.50106 WP_002209852.1.50984 WP_002209852.1.51284 WP_002209852.1.51293 WP_002209852.1.51588 WP_002209852.1.51772 WP_002209852.1.51934 WP_002209852.1.52158 WP_002209852.1.52247 WP_002209852.1.52473 WP_002209852.1.52734 WP_002209852.1.52792 WP_002209852.1.52819 WP_002209852.1.52969 WP_002209852.1.53300 WP_002209852.1.53838 WP_002209852.1.53848 WP_002209852.1.53953 WP_002209852.1.54568 WP_002209852.1.54951 WP_002209852.1.55194 WP_002209852.1.55695 WP_002209852.1.5592 WP_002209852.1.56031 WP_002209852.1.56912 WP_002209852.1.56953 WP_002209852.1.57585 WP_002209852.1.57657 WP_002209852.1.58067 WP_002209852.1.58543 WP_002209852.1.58794 WP_002209852.1.59102 WP_002209852.1.59431 WP_002209852.1.5957 WP_002209852.1.59635 WP_002209852.1.59687 WP_002209852.1.59789 WP_002209852.1.59885 WP_002209852.1.60437 WP_002209852.1.60707 WP_002209852.1.60896 WP_002209852.1.61689 WP_002209852.1.62232 WP_002209852.1.62342 WP_002209852.1.6270 WP_002209852.1.6333 WP_002209852.1.63387 WP_002209852.1.64142 WP_002209852.1.64474 WP_002209852.1.64780 WP_002209852.1.64786 WP_002209852.1.64910 WP_002209852.1.653 WP_002209852.1.65400 WP_002209852.1.65554 WP_002209852.1.6570 WP_002209852.1.65706 WP_002209852.1.65718 WP_002209852.1.6581 WP_002209852.1.66118 WP_002209852.1.66546 WP_002209852.1.66616 WP_002209852.1.67404 WP_002209852.1.67850 WP_002209852.1.68361 WP_002209852.1.68753 WP_002209852.1.68855 WP_002209852.1.69018 WP_002209852.1.69316 WP_002209852.1.69951 WP_002209852.1.70117 WP_002209852.1.70171 WP_002209852.1.70319 WP_002209852.1.70377 WP_002209852.1.70417 WP_002209852.1.70726 WP_002209852.1.7083 WP_002209852.1.7169 WP_002209852.1.71744 WP_002209852.1.72280 WP_002209852.1.72440 WP_002209852.1.72486 WP_002209852.1.7402 WP_002209852.1.74131 WP_002209852.1.74310 WP_002209852.1.74577 WP_002209852.1.74738 WP_002209852.1.75173 WP_002209852.1.7518 WP_002209852.1.75337 WP_002209852.1.75407 WP_002209852.1.75636 WP_002209852.1.75689 WP_002209852.1.75821 WP_002209852.1.76670 WP_002209852.1.77387 WP_002209852.1.77429 WP_002209852.1.77691 WP_002209852.1.78004 WP_002209852.1.7841 WP_002209852.1.78556 WP_002209852.1.79515 WP_002209852.1.79550 WP_002209852.1.79609 WP_002209852.1.79981 WP_002209852.1.8009 WP_002209852.1.80331 WP_002209852.1.81848 WP_002209852.1.81877 WP_002209852.1.8210 WP_002209852.1.82133 WP_002209852.1.82151 WP_002209852.1.82270 WP_002209852.1.8303 WP_002209852.1.83039 WP_002209852.1.83265 WP_002209852.1.83630 WP_002209852.1.8420 WP_002209852.1.84703 WP_002209852.1.84720 WP_002209852.1.85269 WP_002209852.1.85270 WP_002209852.1.8559 WP_002209852.1.85802 WP_002209852.1.86034 WP_002209852.1.86413 WP_002209852.1.87107 WP_002209852.1.8728 WP_002209852.1.87418 WP_002209852.1.8762 WP_002209852.1.87853 WP_002209852.1.87988 WP_002209852.1.88362 WP_002209852.1.88472 WP_002209852.1.89359 WP_002209852.1.89542 WP_002209852.1.8964 WP_002209852.1.90176 WP_002209852.1.9051 WP_002209852.1.90624 WP_002209852.1.91373 WP_002209852.1.91844 WP_002209852.1.92030 WP_002209852.1.92331 WP_002209852.1.92604 WP_002209852.1.927 WP_002209852.1.9311 WP_002209852.1.9320 WP_002209852.1.93623 WP_002209852.1.93928 WP_002209852.1.93933 WP_002209852.1.94052 WP_002209852.1.94201 WP_002209852.1.94545 WP_002209852.1.94683 WP_002209852.1.95746 WP_002209852.1.95981 WP_002209852.1.97245 WP_002209852.1.97375 WP_002209852.1.97448 WP_002209852.1.97791 WP_002209852.1.97864 WP_002209852.1.97872 WP_002209852.1.97894 WP_002209852.1.99109 WP_002209852.1.99383 WP_002209852.1.9941 WP_002209852.1.99416 WP_002209852.1.99788 WP_002209852.1.99882 WP_002209852.1.99990 YP_002345856.1.25044 gi|162418817|ref|YP_001607605.1| gi|384125330|ref|YP_005507944.1| gi|170023268|ref|YP_001719773.1| gi|384413624|ref|YP_005622986.1| gi|145599000|ref|YP_001163076.1| gi|45442622|ref|NP_994161.1| 187410.y3189 214092.YPO0801 229193.YP_2856 349746.YpAngola_A3255 349747.YpsIP31758_0966 360102.YPA_0468 377628.YPN_3005 386656.YPDSF_1718 502800.YPK_1019 gi|384137210|ref|YP_005519912.1| gi|108813165|ref|YP_648932.1| gi|294503014|ref|YP_003567076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]