SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162419454|ref|YP_001607868.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162419454|ref|YP_001607868.1|
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-19
Family Thioltransferase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162419454|ref|YP_001607868.1|
Sequence length 78
Comment glutaredoxin-like protein NrdH [Yersinia pestis Angola]
Sequence
MSIIIYSKPDCVQCNATYRAFDRQGISYQIIDLTEDEQALNHVKSLGYQQVPVIVAGDEH
WSGFHPDKINALVQAVSV
Download sequence
Identical sequences A0A0E1NW46 A0A0E8XPL1 A0A0H2W6M2 A0A0H2YFH7 A0A0H3B1P1 A0A0M1V299 A0A0T9J1I6 A0A0U1EVK7 A0A0U1QZI4 A0A208S7S7 Q667N7 Q7CJT1
gi|186896374|ref|YP_001873486.1| gi|153949254|ref|YP_001400046.1| gi|162419454|ref|YP_001607868.1| gi|384139516|ref|YP_005522218.1| gi|218929728|ref|YP_002347603.1| gi|170023365|ref|YP_001719870.1| gi|108811300|ref|YP_647067.1| WP_002212214.1.100083 WP_002212214.1.100246 WP_002212214.1.100593 WP_002212214.1.10066 WP_002212214.1.100921 WP_002212214.1.100931 WP_002212214.1.10105 WP_002212214.1.101305 WP_002212214.1.101382 WP_002212214.1.101928 WP_002212214.1.102012 WP_002212214.1.102067 WP_002212214.1.10736 WP_002212214.1.10935 WP_002212214.1.10955 WP_002212214.1.11693 WP_002212214.1.12167 WP_002212214.1.12463 WP_002212214.1.12736 WP_002212214.1.12857 WP_002212214.1.1388 WP_002212214.1.14063 WP_002212214.1.14169 WP_002212214.1.14804 WP_002212214.1.15321 WP_002212214.1.15555 WP_002212214.1.15605 WP_002212214.1.15689 WP_002212214.1.16243 WP_002212214.1.16333 WP_002212214.1.17135 WP_002212214.1.17141 WP_002212214.1.17608 WP_002212214.1.17873 WP_002212214.1.17983 WP_002212214.1.18208 WP_002212214.1.18640 WP_002212214.1.18826 WP_002212214.1.19329 WP_002212214.1.19425 WP_002212214.1.19739 WP_002212214.1.19763 WP_002212214.1.20035 WP_002212214.1.20380 WP_002212214.1.20547 WP_002212214.1.2064 WP_002212214.1.20932 WP_002212214.1.21486 WP_002212214.1.21784 WP_002212214.1.21879 WP_002212214.1.21934 WP_002212214.1.22530 WP_002212214.1.22542 WP_002212214.1.22708 WP_002212214.1.23157 WP_002212214.1.23271 WP_002212214.1.23687 WP_002212214.1.23811 WP_002212214.1.24002 WP_002212214.1.2451 WP_002212214.1.24517 WP_002212214.1.25181 WP_002212214.1.25394 WP_002212214.1.26383 WP_002212214.1.2640 WP_002212214.1.26509 WP_002212214.1.26776 WP_002212214.1.26960 WP_002212214.1.27124 WP_002212214.1.27251 WP_002212214.1.2726 WP_002212214.1.28647 WP_002212214.1.28922 WP_002212214.1.29157 WP_002212214.1.29186 WP_002212214.1.29355 WP_002212214.1.2947 WP_002212214.1.29622 WP_002212214.1.2964 WP_002212214.1.29685 WP_002212214.1.29814 WP_002212214.1.3092 WP_002212214.1.30931 WP_002212214.1.311 WP_002212214.1.31336 WP_002212214.1.31496 WP_002212214.1.31721 WP_002212214.1.31739 WP_002212214.1.31805 WP_002212214.1.32343 WP_002212214.1.32388 WP_002212214.1.32446 WP_002212214.1.32736 WP_002212214.1.33203 WP_002212214.1.33324 WP_002212214.1.33661 WP_002212214.1.33775 WP_002212214.1.33937 WP_002212214.1.34031 WP_002212214.1.34138 WP_002212214.1.35389 WP_002212214.1.35538 WP_002212214.1.36088 WP_002212214.1.37174 WP_002212214.1.37494 WP_002212214.1.37863 WP_002212214.1.38147 WP_002212214.1.38235 WP_002212214.1.38532 WP_002212214.1.38743 WP_002212214.1.38824 WP_002212214.1.38993 WP_002212214.1.39066 WP_002212214.1.39346 WP_002212214.1.3976 WP_002212214.1.39858 WP_002212214.1.40071 WP_002212214.1.40134 WP_002212214.1.40534 WP_002212214.1.40853 WP_002212214.1.41196 WP_002212214.1.41984 WP_002212214.1.4210 WP_002212214.1.42361 WP_002212214.1.42490 WP_002212214.1.42976 WP_002212214.1.44408 WP_002212214.1.44598 WP_002212214.1.44603 WP_002212214.1.44832 WP_002212214.1.45198 WP_002212214.1.45214 WP_002212214.1.46262 WP_002212214.1.46545 WP_002212214.1.46686 WP_002212214.1.46697 WP_002212214.1.46731 WP_002212214.1.4678 WP_002212214.1.46891 WP_002212214.1.47387 WP_002212214.1.47440 WP_002212214.1.47769 WP_002212214.1.47881 WP_002212214.1.48166 WP_002212214.1.48722 WP_002212214.1.4889 WP_002212214.1.49315 WP_002212214.1.49906 WP_002212214.1.4997 WP_002212214.1.50010 WP_002212214.1.50093 WP_002212214.1.50106 WP_002212214.1.50185 WP_002212214.1.50984 WP_002212214.1.51284 WP_002212214.1.51293 WP_002212214.1.51588 WP_002212214.1.51772 WP_002212214.1.51934 WP_002212214.1.52158 WP_002212214.1.52247 WP_002212214.1.52473 WP_002212214.1.52569 WP_002212214.1.52734 WP_002212214.1.52792 WP_002212214.1.52819 WP_002212214.1.52969 WP_002212214.1.53147 WP_002212214.1.53300 WP_002212214.1.53838 WP_002212214.1.53848 WP_002212214.1.53883 WP_002212214.1.53953 WP_002212214.1.54568 WP_002212214.1.54951 WP_002212214.1.55194 WP_002212214.1.55695 WP_002212214.1.5592 WP_002212214.1.56031 WP_002212214.1.56912 WP_002212214.1.56953 WP_002212214.1.57585 WP_002212214.1.57657 WP_002212214.1.58067 WP_002212214.1.58543 WP_002212214.1.58794 WP_002212214.1.59102 WP_002212214.1.59431 WP_002212214.1.5957 WP_002212214.1.59635 WP_002212214.1.5968 WP_002212214.1.59687 WP_002212214.1.59789 WP_002212214.1.59885 WP_002212214.1.60437 WP_002212214.1.60707 WP_002212214.1.60896 WP_002212214.1.61689 WP_002212214.1.62232 WP_002212214.1.62342 WP_002212214.1.6270 WP_002212214.1.6333 WP_002212214.1.63387 WP_002212214.1.63517 WP_002212214.1.63641 WP_002212214.1.64142 WP_002212214.1.64474 WP_002212214.1.64780 WP_002212214.1.64786 WP_002212214.1.64910 WP_002212214.1.653 WP_002212214.1.65400 WP_002212214.1.65554 WP_002212214.1.6570 WP_002212214.1.65706 WP_002212214.1.65718 WP_002212214.1.6581 WP_002212214.1.66118 WP_002212214.1.66546 WP_002212214.1.66616 WP_002212214.1.67404 WP_002212214.1.67850 WP_002212214.1.6791 WP_002212214.1.68361 WP_002212214.1.68371 WP_002212214.1.68753 WP_002212214.1.68855 WP_002212214.1.69018 WP_002212214.1.69316 WP_002212214.1.69951 WP_002212214.1.70117 WP_002212214.1.70171 WP_002212214.1.70319 WP_002212214.1.70377 WP_002212214.1.70417 WP_002212214.1.70726 WP_002212214.1.7083 WP_002212214.1.7169 WP_002212214.1.71744 WP_002212214.1.72280 WP_002212214.1.72440 WP_002212214.1.72486 WP_002212214.1.7402 WP_002212214.1.74131 WP_002212214.1.74310 WP_002212214.1.74577 WP_002212214.1.74738 WP_002212214.1.75169 WP_002212214.1.75173 WP_002212214.1.7518 WP_002212214.1.75208 WP_002212214.1.75337 WP_002212214.1.75407 WP_002212214.1.75636 WP_002212214.1.75689 WP_002212214.1.76555 WP_002212214.1.76670 WP_002212214.1.77295 WP_002212214.1.77387 WP_002212214.1.77429 WP_002212214.1.77569 WP_002212214.1.77691 WP_002212214.1.78004 WP_002212214.1.7841 WP_002212214.1.78556 WP_002212214.1.7939 WP_002212214.1.79515 WP_002212214.1.79550 WP_002212214.1.79609 WP_002212214.1.79825 WP_002212214.1.79981 WP_002212214.1.8009 WP_002212214.1.80331 WP_002212214.1.81848 WP_002212214.1.81877 WP_002212214.1.8210 WP_002212214.1.82133 WP_002212214.1.82151 WP_002212214.1.82270 WP_002212214.1.82436 WP_002212214.1.82619 WP_002212214.1.8303 WP_002212214.1.83039 WP_002212214.1.83265 WP_002212214.1.83630 WP_002212214.1.8420 WP_002212214.1.84703 WP_002212214.1.84720 WP_002212214.1.85269 WP_002212214.1.85270 WP_002212214.1.8559 WP_002212214.1.85802 WP_002212214.1.86034 WP_002212214.1.86059 WP_002212214.1.86413 WP_002212214.1.87107 WP_002212214.1.8728 WP_002212214.1.87418 WP_002212214.1.8762 WP_002212214.1.87853 WP_002212214.1.87988 WP_002212214.1.88362 WP_002212214.1.88472 WP_002212214.1.89359 WP_002212214.1.89542 WP_002212214.1.8964 WP_002212214.1.90176 WP_002212214.1.9051 WP_002212214.1.90624 WP_002212214.1.91373 WP_002212214.1.91844 WP_002212214.1.92030 WP_002212214.1.92331 WP_002212214.1.92604 WP_002212214.1.927 WP_002212214.1.9311 WP_002212214.1.9320 WP_002212214.1.93623 WP_002212214.1.93928 WP_002212214.1.93933 WP_002212214.1.94052 WP_002212214.1.94201 WP_002212214.1.94545 WP_002212214.1.94683 WP_002212214.1.95746 WP_002212214.1.95981 WP_002212214.1.97245 WP_002212214.1.97375 WP_002212214.1.97448 WP_002212214.1.97791 WP_002212214.1.97864 WP_002212214.1.97872 WP_002212214.1.97894 WP_002212214.1.99109 WP_002212214.1.99383 WP_002212214.1.9941 WP_002212214.1.99416 WP_002212214.1.99788 WP_002212214.1.99882 WP_002212214.1.99972 WP_002212214.1.99990 YP_002347603.1.25044 gi|22125126|ref|NP_668549.1| gi|51597270|ref|YP_071461.1| gi|108808373|ref|YP_652289.1| gi|384415635|ref|YP_005624997.1| gi|45442238|ref|NP_993777.1| 187410.y1225 214092.YPO2651 229193.YP_2453 273123.YPTB2955 349746.YpAngola_A3540 349747.YpsIP31758_1065 360102.YPA_2379 377628.YPN_1137 502800.YPK_1119 502801.YPTS_3072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]