SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162419577|ref|YP_001606590.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162419577|ref|YP_001606590.1|
Domain Number 1 Region: 16-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.4e-34
Family Glutathione peroxidase-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162419577|ref|YP_001606590.1|
Sequence length 156
Comment thiol-disulfide oxidoreductase [Yersinia pestis Angola]
Sequence
MCSLLLLLSACKQEKVALGEVAPTLAAYDLQGEAVALEQWEGKLVYLNFWSVNCGGCLAE
MATLNQLSQEYQDQAVVVAINTDPEQVEIAPVLAQHNINYPVIRDQLGITQERYQVIGTP
TSFLIDRNGKVIEWHQGVRNEQELTALFKQKVSEKQ
Download sequence
Identical sequences A0A0E1NW34
gi|162419577|ref|YP_001606590.1| 349746.YpAngola_A2137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]