SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162420308|ref|YP_001607022.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162420308|ref|YP_001607022.1|
Domain Number 1 Region: 4-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.76e-54
Family Glutathione peroxidase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162420308|ref|YP_001607022.1|
Sequence length 184
Comment putative glutathione peroxidase [Yersinia pestis Angola]
Sequence
MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEV
LGFPSNEFAGQEPGSDEEIHAFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVK
PEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLARFAPDMAPEAPILINAINQA
LASH
Download sequence
Identical sequences A0A0E1NNM5 A0A0H2W5I3 A0A0H2YID6 A0A0H3B165 A0A0M1V3D5 A0A0U1ENL4 A0A0U1R082 A0A208S436 A0A2A7VEU4 Q66A00 Q7CIU3
gi|384125979|ref|YP_005508593.1| gi|153949548|ref|YP_001400698.1| gi|108807763|ref|YP_651679.1| gi|145598029|ref|YP_001162105.1| gi|186895713|ref|YP_001872825.1| WP_002211827.1.100083 WP_002211827.1.100246 WP_002211827.1.100921 WP_002211827.1.100931 WP_002211827.1.10105 WP_002211827.1.101305 WP_002211827.1.101382 WP_002211827.1.101928 WP_002211827.1.102012 WP_002211827.1.102067 WP_002211827.1.10736 WP_002211827.1.10935 WP_002211827.1.10955 WP_002211827.1.11693 WP_002211827.1.12167 WP_002211827.1.12463 WP_002211827.1.12736 WP_002211827.1.12857 WP_002211827.1.1388 WP_002211827.1.14063 WP_002211827.1.14169 WP_002211827.1.14804 WP_002211827.1.15321 WP_002211827.1.15555 WP_002211827.1.15605 WP_002211827.1.15689 WP_002211827.1.16243 WP_002211827.1.16333 WP_002211827.1.17135 WP_002211827.1.17141 WP_002211827.1.17608 WP_002211827.1.17873 WP_002211827.1.17983 WP_002211827.1.18208 WP_002211827.1.18640 WP_002211827.1.18826 WP_002211827.1.19329 WP_002211827.1.19425 WP_002211827.1.19739 WP_002211827.1.19763 WP_002211827.1.20380 WP_002211827.1.20547 WP_002211827.1.2064 WP_002211827.1.20932 WP_002211827.1.21784 WP_002211827.1.21879 WP_002211827.1.21934 WP_002211827.1.22530 WP_002211827.1.22542 WP_002211827.1.22708 WP_002211827.1.23157 WP_002211827.1.23271 WP_002211827.1.23687 WP_002211827.1.23811 WP_002211827.1.24002 WP_002211827.1.2451 WP_002211827.1.25181 WP_002211827.1.25394 WP_002211827.1.26383 WP_002211827.1.2640 WP_002211827.1.26776 WP_002211827.1.26960 WP_002211827.1.27124 WP_002211827.1.27251 WP_002211827.1.2726 WP_002211827.1.28647 WP_002211827.1.28922 WP_002211827.1.29157 WP_002211827.1.29186 WP_002211827.1.29355 WP_002211827.1.2947 WP_002211827.1.29622 WP_002211827.1.2964 WP_002211827.1.29685 WP_002211827.1.29814 WP_002211827.1.3092 WP_002211827.1.30931 WP_002211827.1.311 WP_002211827.1.31336 WP_002211827.1.31496 WP_002211827.1.31721 WP_002211827.1.31739 WP_002211827.1.31805 WP_002211827.1.32343 WP_002211827.1.32388 WP_002211827.1.32446 WP_002211827.1.32736 WP_002211827.1.33203 WP_002211827.1.33324 WP_002211827.1.33661 WP_002211827.1.33775 WP_002211827.1.33937 WP_002211827.1.34031 WP_002211827.1.34138 WP_002211827.1.35389 WP_002211827.1.36088 WP_002211827.1.37174 WP_002211827.1.37494 WP_002211827.1.37863 WP_002211827.1.38147 WP_002211827.1.38235 WP_002211827.1.38532 WP_002211827.1.38743 WP_002211827.1.38824 WP_002211827.1.38993 WP_002211827.1.39066 WP_002211827.1.39346 WP_002211827.1.3976 WP_002211827.1.39858 WP_002211827.1.40071 WP_002211827.1.40134 WP_002211827.1.40534 WP_002211827.1.40853 WP_002211827.1.41196 WP_002211827.1.4210 WP_002211827.1.42361 WP_002211827.1.42490 WP_002211827.1.42976 WP_002211827.1.44408 WP_002211827.1.44598 WP_002211827.1.44603 WP_002211827.1.44832 WP_002211827.1.45198 WP_002211827.1.45214 WP_002211827.1.46262 WP_002211827.1.46697 WP_002211827.1.46731 WP_002211827.1.4678 WP_002211827.1.46891 WP_002211827.1.47387 WP_002211827.1.47440 WP_002211827.1.48166 WP_002211827.1.48722 WP_002211827.1.4889 WP_002211827.1.49315 WP_002211827.1.49906 WP_002211827.1.4997 WP_002211827.1.50010 WP_002211827.1.50093 WP_002211827.1.50106 WP_002211827.1.50185 WP_002211827.1.50984 WP_002211827.1.51284 WP_002211827.1.51293 WP_002211827.1.51588 WP_002211827.1.51772 WP_002211827.1.51934 WP_002211827.1.52158 WP_002211827.1.52247 WP_002211827.1.52473 WP_002211827.1.52734 WP_002211827.1.52792 WP_002211827.1.52819 WP_002211827.1.52969 WP_002211827.1.53300 WP_002211827.1.53838 WP_002211827.1.53848 WP_002211827.1.53883 WP_002211827.1.53953 WP_002211827.1.54568 WP_002211827.1.54951 WP_002211827.1.55695 WP_002211827.1.5592 WP_002211827.1.56031 WP_002211827.1.56912 WP_002211827.1.56953 WP_002211827.1.57585 WP_002211827.1.57657 WP_002211827.1.58067 WP_002211827.1.58543 WP_002211827.1.58794 WP_002211827.1.59102 WP_002211827.1.59431 WP_002211827.1.5957 WP_002211827.1.59635 WP_002211827.1.5968 WP_002211827.1.59687 WP_002211827.1.59789 WP_002211827.1.59885 WP_002211827.1.60437 WP_002211827.1.60707 WP_002211827.1.60896 WP_002211827.1.61689 WP_002211827.1.62232 WP_002211827.1.62342 WP_002211827.1.6270 WP_002211827.1.6333 WP_002211827.1.63387 WP_002211827.1.63641 WP_002211827.1.64474 WP_002211827.1.64780 WP_002211827.1.64910 WP_002211827.1.653 WP_002211827.1.65400 WP_002211827.1.65554 WP_002211827.1.6570 WP_002211827.1.65706 WP_002211827.1.65718 WP_002211827.1.6581 WP_002211827.1.66118 WP_002211827.1.66546 WP_002211827.1.66616 WP_002211827.1.67404 WP_002211827.1.67850 WP_002211827.1.6791 WP_002211827.1.68361 WP_002211827.1.68371 WP_002211827.1.68753 WP_002211827.1.68855 WP_002211827.1.69018 WP_002211827.1.69316 WP_002211827.1.69951 WP_002211827.1.70117 WP_002211827.1.70171 WP_002211827.1.70319 WP_002211827.1.70377 WP_002211827.1.70417 WP_002211827.1.70726 WP_002211827.1.7083 WP_002211827.1.7169 WP_002211827.1.71744 WP_002211827.1.72280 WP_002211827.1.72440 WP_002211827.1.72486 WP_002211827.1.7402 WP_002211827.1.74131 WP_002211827.1.74310 WP_002211827.1.74577 WP_002211827.1.74738 WP_002211827.1.75169 WP_002211827.1.75173 WP_002211827.1.7518 WP_002211827.1.75208 WP_002211827.1.75337 WP_002211827.1.75407 WP_002211827.1.75636 WP_002211827.1.75689 WP_002211827.1.75821 WP_002211827.1.76555 WP_002211827.1.76670 WP_002211827.1.77295 WP_002211827.1.77387 WP_002211827.1.77429 WP_002211827.1.77569 WP_002211827.1.77691 WP_002211827.1.78004 WP_002211827.1.7841 WP_002211827.1.78556 WP_002211827.1.79515 WP_002211827.1.79550 WP_002211827.1.79609 WP_002211827.1.79825 WP_002211827.1.79981 WP_002211827.1.8009 WP_002211827.1.80331 WP_002211827.1.81848 WP_002211827.1.81877 WP_002211827.1.8210 WP_002211827.1.82133 WP_002211827.1.82270 WP_002211827.1.82436 WP_002211827.1.82619 WP_002211827.1.8303 WP_002211827.1.83039 WP_002211827.1.83265 WP_002211827.1.83630 WP_002211827.1.8420 WP_002211827.1.84703 WP_002211827.1.84720 WP_002211827.1.85269 WP_002211827.1.85270 WP_002211827.1.8559 WP_002211827.1.85802 WP_002211827.1.86034 WP_002211827.1.86413 WP_002211827.1.87107 WP_002211827.1.8728 WP_002211827.1.87418 WP_002211827.1.8762 WP_002211827.1.87853 WP_002211827.1.87988 WP_002211827.1.88362 WP_002211827.1.88472 WP_002211827.1.89359 WP_002211827.1.89542 WP_002211827.1.8964 WP_002211827.1.90176 WP_002211827.1.9051 WP_002211827.1.90624 WP_002211827.1.91263 WP_002211827.1.91373 WP_002211827.1.91844 WP_002211827.1.92030 WP_002211827.1.92331 WP_002211827.1.92604 WP_002211827.1.927 WP_002211827.1.9311 WP_002211827.1.93623 WP_002211827.1.93933 WP_002211827.1.94052 WP_002211827.1.94201 WP_002211827.1.94545 WP_002211827.1.94683 WP_002211827.1.95746 WP_002211827.1.95981 WP_002211827.1.97245 WP_002211827.1.97375 WP_002211827.1.97448 WP_002211827.1.97791 WP_002211827.1.97864 WP_002211827.1.97872 WP_002211827.1.97894 WP_002211827.1.99109 WP_002211827.1.99383 WP_002211827.1.9941 WP_002211827.1.99416 WP_002211827.1.99788 WP_002211827.1.99882 WP_002211827.1.99972 WP_002211827.1.99990 YP_002347387.1.25044 gi|384414575|ref|YP_005623937.1| gi|294503573|ref|YP_003567635.1| gi|162420308|ref|YP_001607022.1| gi|45442001|ref|NP_993540.1| gi|22125808|ref|NP_669231.1| gi|51596656|ref|YP_070847.1| gi|170024068|ref|YP_001720573.1| gi|218929512|ref|YP_002347387.1| 187410.y1915 214092.YPO2424 229193.YP_2211 273123.YPTB2332 349746.YpAngola_A2615 349747.YpsIP31758_1721 360102.YPA_1768 377628.YPN_1878 386656.YPDSF_0726 502800.YPK_1829 502801.YPTS_2407 gi|384139751|ref|YP_005522453.1| gi|108812040|ref|YP_647807.1| gi|384122019|ref|YP_005504639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]