SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162420340|ref|YP_001607504.1| from Yersinia pestis Angola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162420340|ref|YP_001607504.1|
Domain Number 1 Region: 11-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.86e-31
Family ArsC-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162420340|ref|YP_001607504.1|
Sequence length 132
Comment hypothetical protein YpAngola_A3142 [Yersinia pestis Angola]
Sequence
MSDRPVTPALRLYGIKNCDTIKKARRWLEEQGIAYQFHDYRADGLSDECLQGFIDTLGWE
PLLNTRGTTWRKLPPEQRDAITDAQSAKALMLAQPAIIKRPLLEGPNGEMLLGFKIESYQ
EFIHNQPATEVQ
Download sequence
Identical sequences A0A0E1NVZ7 A0A0H2YG08 A0A0M1VDB5 A0A0U1ESM9 A0A0U1QVH7 A0A208S7K3 Q0WCL6 Q668G6 Q7CJI8
gi|153947548|ref|YP_001400236.1| gi|22125326|ref|NP_668749.1| 187410.y1428 214092.YPO3052 229193.YP_2674 273123.YPTB2774 349746.YpAngola_A3142 349747.YpsIP31758_1256 360102.YPA_2243 377628.YPN_1333 386656.YPDSF_2157 502801.YPTS_2878 gi|294504799|ref|YP_003568861.1| gi|186896180|ref|YP_001873292.1| gi|51597090|ref|YP_071281.1| gi|162420340|ref|YP_001607504.1| gi|384139102|ref|YP_005521804.1| gi|108811496|ref|YP_647263.1| gi|145599431|ref|YP_001163507.1| gi|45442448|ref|NP_993987.1| gi|218930097|ref|YP_002347972.1| gi|384127121|ref|YP_005509735.1| WP_002208548.1.100083 WP_002208548.1.100246 WP_002208548.1.100593 WP_002208548.1.10066 WP_002208548.1.100921 WP_002208548.1.100931 WP_002208548.1.10105 WP_002208548.1.101305 WP_002208548.1.101382 WP_002208548.1.101928 WP_002208548.1.102012 WP_002208548.1.102067 WP_002208548.1.10736 WP_002208548.1.10935 WP_002208548.1.10955 WP_002208548.1.11693 WP_002208548.1.12463 WP_002208548.1.12736 WP_002208548.1.12857 WP_002208548.1.1388 WP_002208548.1.14063 WP_002208548.1.14169 WP_002208548.1.14804 WP_002208548.1.15321 WP_002208548.1.15555 WP_002208548.1.15605 WP_002208548.1.15689 WP_002208548.1.16243 WP_002208548.1.16333 WP_002208548.1.17135 WP_002208548.1.17141 WP_002208548.1.17608 WP_002208548.1.17873 WP_002208548.1.17983 WP_002208548.1.18208 WP_002208548.1.18640 WP_002208548.1.19329 WP_002208548.1.19425 WP_002208548.1.19739 WP_002208548.1.19763 WP_002208548.1.20035 WP_002208548.1.20380 WP_002208548.1.2064 WP_002208548.1.20932 WP_002208548.1.21486 WP_002208548.1.21784 WP_002208548.1.21879 WP_002208548.1.21934 WP_002208548.1.22530 WP_002208548.1.22542 WP_002208548.1.22708 WP_002208548.1.23157 WP_002208548.1.23271 WP_002208548.1.23687 WP_002208548.1.23811 WP_002208548.1.24002 WP_002208548.1.2451 WP_002208548.1.24517 WP_002208548.1.25394 WP_002208548.1.26383 WP_002208548.1.2640 WP_002208548.1.26776 WP_002208548.1.26960 WP_002208548.1.27124 WP_002208548.1.27251 WP_002208548.1.2726 WP_002208548.1.28647 WP_002208548.1.28922 WP_002208548.1.29157 WP_002208548.1.29186 WP_002208548.1.29355 WP_002208548.1.2947 WP_002208548.1.29622 WP_002208548.1.2964 WP_002208548.1.29685 WP_002208548.1.29814 WP_002208548.1.3092 WP_002208548.1.31336 WP_002208548.1.31496 WP_002208548.1.31721 WP_002208548.1.31739 WP_002208548.1.31805 WP_002208548.1.32343 WP_002208548.1.32388 WP_002208548.1.32446 WP_002208548.1.32736 WP_002208548.1.33203 WP_002208548.1.33324 WP_002208548.1.33661 WP_002208548.1.33775 WP_002208548.1.33937 WP_002208548.1.34031 WP_002208548.1.34138 WP_002208548.1.35389 WP_002208548.1.35538 WP_002208548.1.36088 WP_002208548.1.37174 WP_002208548.1.37494 WP_002208548.1.37863 WP_002208548.1.38147 WP_002208548.1.38235 WP_002208548.1.38743 WP_002208548.1.38824 WP_002208548.1.39066 WP_002208548.1.39346 WP_002208548.1.39858 WP_002208548.1.40071 WP_002208548.1.40134 WP_002208548.1.40534 WP_002208548.1.40853 WP_002208548.1.41196 WP_002208548.1.41984 WP_002208548.1.4210 WP_002208548.1.42361 WP_002208548.1.42490 WP_002208548.1.44408 WP_002208548.1.44598 WP_002208548.1.44603 WP_002208548.1.44832 WP_002208548.1.45198 WP_002208548.1.45214 WP_002208548.1.46262 WP_002208548.1.46545 WP_002208548.1.46686 WP_002208548.1.46697 WP_002208548.1.4678 WP_002208548.1.46891 WP_002208548.1.47387 WP_002208548.1.47769 WP_002208548.1.47881 WP_002208548.1.48166 WP_002208548.1.48722 WP_002208548.1.4889 WP_002208548.1.49906 WP_002208548.1.4997 WP_002208548.1.50010 WP_002208548.1.50093 WP_002208548.1.50106 WP_002208548.1.50185 WP_002208548.1.50984 WP_002208548.1.51284 WP_002208548.1.51293 WP_002208548.1.51588 WP_002208548.1.51772 WP_002208548.1.51934 WP_002208548.1.52158 WP_002208548.1.52247 WP_002208548.1.52473 WP_002208548.1.52734 WP_002208548.1.52819 WP_002208548.1.52969 WP_002208548.1.53147 WP_002208548.1.53300 WP_002208548.1.53838 WP_002208548.1.53848 WP_002208548.1.53883 WP_002208548.1.53953 WP_002208548.1.54568 WP_002208548.1.54951 WP_002208548.1.55194 WP_002208548.1.55695 WP_002208548.1.5592 WP_002208548.1.56912 WP_002208548.1.56953 WP_002208548.1.57585 WP_002208548.1.57657 WP_002208548.1.58067 WP_002208548.1.58543 WP_002208548.1.58794 WP_002208548.1.59102 WP_002208548.1.59431 WP_002208548.1.5957 WP_002208548.1.59635 WP_002208548.1.5968 WP_002208548.1.59687 WP_002208548.1.60437 WP_002208548.1.60707 WP_002208548.1.61689 WP_002208548.1.62232 WP_002208548.1.62342 WP_002208548.1.6270 WP_002208548.1.6333 WP_002208548.1.63387 WP_002208548.1.63641 WP_002208548.1.64142 WP_002208548.1.64474 WP_002208548.1.64780 WP_002208548.1.64786 WP_002208548.1.64910 WP_002208548.1.653 WP_002208548.1.65400 WP_002208548.1.65554 WP_002208548.1.6570 WP_002208548.1.65706 WP_002208548.1.65718 WP_002208548.1.6581 WP_002208548.1.66118 WP_002208548.1.66546 WP_002208548.1.66616 WP_002208548.1.67404 WP_002208548.1.67850 WP_002208548.1.6791 WP_002208548.1.68361 WP_002208548.1.68753 WP_002208548.1.68855 WP_002208548.1.69018 WP_002208548.1.69316 WP_002208548.1.69951 WP_002208548.1.70117 WP_002208548.1.70171 WP_002208548.1.70319 WP_002208548.1.70377 WP_002208548.1.70417 WP_002208548.1.70726 WP_002208548.1.7083 WP_002208548.1.7169 WP_002208548.1.71744 WP_002208548.1.72280 WP_002208548.1.72440 WP_002208548.1.72486 WP_002208548.1.7402 WP_002208548.1.74131 WP_002208548.1.74310 WP_002208548.1.74577 WP_002208548.1.74738 WP_002208548.1.75169 WP_002208548.1.75173 WP_002208548.1.7518 WP_002208548.1.75208 WP_002208548.1.75407 WP_002208548.1.75636 WP_002208548.1.75689 WP_002208548.1.75821 WP_002208548.1.76670 WP_002208548.1.77295 WP_002208548.1.77387 WP_002208548.1.77429 WP_002208548.1.77569 WP_002208548.1.77691 WP_002208548.1.78004 WP_002208548.1.7841 WP_002208548.1.78556 WP_002208548.1.79515 WP_002208548.1.79550 WP_002208548.1.79609 WP_002208548.1.79825 WP_002208548.1.79981 WP_002208548.1.8009 WP_002208548.1.80331 WP_002208548.1.81848 WP_002208548.1.81877 WP_002208548.1.8210 WP_002208548.1.82133 WP_002208548.1.82151 WP_002208548.1.82270 WP_002208548.1.82619 WP_002208548.1.8303 WP_002208548.1.83265 WP_002208548.1.83630 WP_002208548.1.8420 WP_002208548.1.84703 WP_002208548.1.84720 WP_002208548.1.85269 WP_002208548.1.85270 WP_002208548.1.8559 WP_002208548.1.85802 WP_002208548.1.86034 WP_002208548.1.86059 WP_002208548.1.86413 WP_002208548.1.87107 WP_002208548.1.8728 WP_002208548.1.87418 WP_002208548.1.8762 WP_002208548.1.87853 WP_002208548.1.87988 WP_002208548.1.88362 WP_002208548.1.88472 WP_002208548.1.89359 WP_002208548.1.89542 WP_002208548.1.8964 WP_002208548.1.90176 WP_002208548.1.9051 WP_002208548.1.90624 WP_002208548.1.91263 WP_002208548.1.91373 WP_002208548.1.91844 WP_002208548.1.92030 WP_002208548.1.92331 WP_002208548.1.927 WP_002208548.1.9311 WP_002208548.1.9320 WP_002208548.1.93623 WP_002208548.1.93928 WP_002208548.1.93933 WP_002208548.1.94052 WP_002208548.1.94201 WP_002208548.1.94545 WP_002208548.1.94683 WP_002208548.1.95746 WP_002208548.1.95981 WP_002208548.1.97245 WP_002208548.1.97375 WP_002208548.1.97448 WP_002208548.1.97791 WP_002208548.1.97864 WP_002208548.1.97872 WP_002208548.1.97894 WP_002208548.1.99109 WP_002208548.1.99383 WP_002208548.1.9941 WP_002208548.1.99416 WP_002208548.1.99788 WP_002208548.1.99972 WP_002208548.1.99990 YP_002347972.1.25044 gi|384123265|ref|YP_005505885.1| gi|384413882|ref|YP_005623244.1| gi|108808237|ref|YP_652153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]