SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|11264|gm1.11264_g from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|11264|gm1.11264_g
Domain Number 1 Region: 1160-1325,1365-1442
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-18
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 312-375,452-550,630-700
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000133
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 3 Region: 729-963
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000018
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 4 Region: 1500-1737
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000212
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Triha1|11264|gm1.11264_g
Domain Number - Region: 1742-1785
Classification Level Classification E-value
Superfamily EF-hand 0.00198
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|11264|gm1.11264_g
Sequence length 2081
Sequence
MSSERPDDDRTVRPPPLVLQGANSSDNHREPTRTNNEPGLSTYWHPSYSSSSHDSINFDS
HIDPTALQAALPPDIPPPLSQSPHFAPDSYHPFDGGSQYIEESANPYYSDSDRVPLTAGV
QPISGTHNEDAHGILARSSFQTVRDDDNAPIRDQEGKNFGHGSNSGYLSAGHQSYGLTLD
PGDFRLSRSPSTSGAFHRAGSIVRAMSQRVVNLSGESDITDQGSSRYRSRSRDSSSERPA
NPATTTYGAESYYGRPASSREEKASQNLFLTTDIPPRAARAKPLNPLKGKTLGIFSPENR
FRLWMCDILVNPFTEPFILVLIIAQTILLAVESWPDVFSPGNERSERWGKKPIDWTMLGL
FIIFTLEIGARIVVSGLILNAAEYSTIDRKRGIRAAVEDRYKTIFRPERQKSTKRVRSTQ
PQAPAFARSFTTLMQGPQTGPKTIEDQQRFQLARRAFLRHSFNRMDFVAVVSFWITFGLS
ISGTENRRHFFLFKMLSCLRILRLLALTHGTAIILRSLKKAAPLLVRVAFLISFFWLLFA
IIGIQSFKSSLSRQCVWLDPLDPTNLTASFTNSMEFCGGYLDNATGATRPWVKFSTPGSL
DNLARGTAEGKGFLCPRGSICLQQDNPYNGTVNFDNILHSLELVFVLMSANTFSDLMYYT
MGSDYPQAALFFGAAIMIMMLWLTNLLIAVITSSFQVIREESKSSAFTVEAEPSSQSHAD
ERKRKISPAQNLYRKTSFFWLVVVAFALLSEACRSASMSHTREKFINAAEIVVTILLDVE
IIIRTVAFWPRFHRSWQNLFDLALAIITSAILIPPIHNTRVYAWLTVFQVLRAYRIVLAI
PVTRKLILLVLGSAAGIGNLMLFVFLMTFLVAILAAQLFRGQIPVYDDDGNLNRISFNTI
FNSFLGMYQILSSENWTAILYSVTSYTTATKTAWIGAIFLIGWFILSFFILINMFIAVIQ
ENFDVSEDEKRLEQVKAFLQRKELGRTANNLTLSTIFSWGKSRRRKDPLDYGPGMMEMLL
KDTVVQEFLDDEVADPLRLNPEHRGPPQRSTTRLMGDGRPGFLKKIWSRIHKSEPNPFYS
NIRFDGPNGTLDPRQMARQAVTATSARRKAQRDYLAQYPRYNTSLYIFPPNSRIRRFCQS
LVGPARGLERFDGVEPNRIAWYTISTFIYASVFAMVVIACVTTPLYQKEYRDHHPATMTQ
WYIWTDMAFAVIFTIEAIIKIIADGLLWTPNAFLRSSWGIIDAVVLVTLWINVVTLLIDD
GAISRALGAFKALRALRLLNVSDSARDTFHSLIIVGWWKLLGAAFVSISLLIPFAIYGLN
LFNGELVSCNDSGDISLLSQCFGEFNSTPYSSDWPILAPRVAANPYFSFDDFGSSLFTLF
QIVSQEGWVDVSFAAQAIVGRGMQPQDAANQGNAMFFVVFNLLATVFILTLFISVFMRNY
TEQTGVAYLTAEQRSWLELRKLLRHISPSKSSYDESENKWKKWCHKRAIEKRGKWYQAVT
VVLVLHLALLVAEFNDEPSWWTTTREYVFLLFSLIYISNITIRILGLGWTRFRRSSWDLY
SLVAVSGAFIATLALLIADARADTYVQLQKIFLVAIVLLVIPRNDALDQLFKTAAASLPV
IGNLLATWFVFFLVFAIAMTQTFSLTRFGDNEGSDINFRTVPMALIFLFRMSLGEGWNQI
MEDYAGIEPPLCVEAESFFDSDCGSKPWARFLFIAWNIVSMYIFVNLFVSLIFESFSYVY
QRSSGMSAVDRDEIRRFKEAWRSVDPAGTGYITKEAFPRLLGELSGVFQMRIYEAEDSVR
QILDDVREDIRMSRHTSIVSMAALNDIDINKLNERLSHLDVKKIRKRRHRFNIFYEEVLV
SADPDKGIAFTDVLMILAHYNIINDSKSLRLEEFLRRRARLQRVDEGIRRRIVQGFFDTL
YWSRKFKAHMERKRASRMTTIPQLRIPDILVEDDEDDSFSAQTEAKLSQLGTGAGEDGHR
KSAWPPESIADGGAMHNHPLGLPRESLSVNEESGGISTFSFELEMPDVREATVAELERPV
DDANLDSVQDMLDGSVWIDSIRRSATLRSTDRSSYRYDDLP
Download sequence
Identical sequences jgi|Triha1|11264|gm1.11264_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]