SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|121386|estExt_Genewise1Plus.C_11_t10058 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|121386|estExt_Genewise1Plus.C_11_t10058
Domain Number 1 Region: 256-431
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.28e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 2 Region: 407-508
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-20
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 3 Region: 582-619,692-774
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000013
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|121386|estExt_Genewise1Plus.C_11_t10058
Sequence length 1125
Sequence
MFSNLSNIVQRAQQLIDPTQGLNLSNSDRNPSKASLFQSQFRLPSSQTPLYEINAELTIP
PSNTTRGDPDHDRGWHYAGKLHLSEAYLCFSTTPTSFTQSASTSTSSAFTGQTNGSGPSG
SGFTFPLCAVRRVERLNSQNFQFALAITTWNGLLADVAKPKDSNNGNKDVREQRITIHLA
GTRQACERFCDGLKRGLRAGVGNVGKLRKVVAECYSEHLLRTDDRANVSPPDAGLGMAFR
YPGDPKKLRDRAKMRLWAEYLRDNGRNMMLIRQPTFHKLIRVGLPNRLRGEIWEVTSGSL
YLRLENPTLYSDTLAKFKGQESLAIDEIEKDLNRSLPEYPGFQSEEGIGRLRRVLTAYSW
VNPDVGYCQAMNIVVAALLIYMSEPQAFFLLSALCDRLVPGYYSTTMYGTLLDQKVFESL
VEKTMPILWEHLVKSDVQLSVVSLPWFLSLYINSMPLVFAFRVLDVFFVEGPKVLFQVGL
AILRINGEELLDAADDGAFISVLKSYFARLDESAHPKSENPKLRAVTRFQELMVVAFKEF
AGVTHSSITELRLKNKDAVLSNIESFAKRTAIRNLGPDSKLLSPEELGSLYDRFYNVLYE
RQQRDRMIQEELQRQAKSSRLRGSDAFPSAAPNEVEKGRVGLGPSTSLMDYDAFREFLAG
MSKWAISDSQANEARLYNNRRTPDAMSPWGNGPEPAEHEFLRRIFNKWDVDGTSALTLQN
VVTGLARIKGKRDIMGTITYFFELYDDDNDGRVDREGILRISEALLFLSRRGLEGTLTPG
ASTVGLNGDGMSASDSQSSLPPEISNAERFLGSVSAFIRRCFEYADPDHPKNQDSTGFDS
FGSNDEMVDPNAFAIGDDDDSEEEEDLLALDSPTATPTKAKKPVDLLSPNDQSDGVDNES
RRRVSKAKAEAANAALDPAHPLHITLPTFRMVVLADELLEQFFECSFPASLHIIEGLQTP
SSFSYAPSLTTFSNLGFNTRSQSQTQAGPIGGGRGLRGVLDNIVTDGMRVASEVRRRMEE
AQRELEKNALPSQRTEEDEEDDDDVGVAIGVRRGTGGASTDVERRSVMSTDRDLLDGADA
EAGSAVPTKEPGHDHNLLEVDTAAGRRRANSSSTTGGPGVVEFEG
Download sequence
Identical sequences jgi|Triha1|121386|estExt_Genewise1Plus.C_11_t10058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]