SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|2481|gm1.2481_g from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|2481|gm1.2481_g
Domain Number 1 Region: 41-170
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.85e-26
Family PLC-like (P variant) 0.038
Further Details:      
 
Domain Number 2 Region: 282-385
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.68e-21
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 3 Region: 523-593
Classification Level Classification E-value
Superfamily EF-hand 0.0000000257
Family Penta-EF-hand proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|2481|gm1.2481_g
Sequence length 1122
Sequence
MRILPNRLLSSSPSPGVNSRSESPMRPKNDGTGPAGVAANGLALRVVIMRARNLAAKDRS
GTSDPYLVVTLGDARVVTHSVPKTLNPEWNVIEELPISSVQSLVVGVICWDKDRFGKDYL
GEFDLALEEIFQNEVAEQEPRWYPLKSKRPGKKTSVVSGEVQLQFTLLDTTAPFLPQQQL
FEKFYALIGTVPVGSSRNVTPTETPLLTPSAAAHLGGSSSPDGLGDEDDEDYLTELEEDI
ADDAEDPSKPETAEKRRRRLRIRGLKKKRRQDPYAFTNGDSDVVGIIYLEISKITDLPPE
SNLTRTGFDMDPFVVASLGKKTYRTKRVRHNLNPVFNEKMIFPVQNHEKQYSFAFTVIDH
DKYSGNDFIASCNLPIQTLIEKAPQANPETGLYEVRSPEPEPMPAPVPTKSRLQKLGVSR
SSSTQSLSKMMKAQAPRSTPSNGSSSLTALGDGSGPQSSSTSLAPADALSNTPVEASEQA
MESDDPDLAEYAIPLKMKNLDKWESKHNPVIYMRAKYVPYPALRQQFWRALLKQYDTDES
GLISRIELSTMLDTLGSTLKDSTIDSFFQRFPHKAADNEDSWELTFDEAVLCLEDQLQAK
SRSGSKTPILDVKSLSLSSKSSGDSTGQPGSDGSGNSTPQIMVEPPAAEPTTPIPEISTP
NEEGEEGYFDQDSKEEHVVEIRECPICHQPRLNKRSDGDIVTHIATCASQDWRQVNTVLV
SGFVTASQAQRKWYSKVITKISYGGYKLGANSANILVQDRLTGQINEEKMSVYVRLGIRL
LYKGLKSKDMETKRIRRMLKNLSIKQGKKFDDPASRDEIEKFIDFHRLDMSEVLLPIEEF
KNFNEFFYRALKPGARPCSAPDNPRIIVSPADCRSVVFNQISQATKIWVKGREFNMKRLL
GDAYPDDVSRYENGALGIFRLAPQDYHRFHIPVDGVMGKPITIAGEYYTVNPMAIRSALD
VYGENVRVLVPIDSEVHGRVMVICVGAMMVGSTIITRKEGEHVRRAEELGYFAFGGSTVL
LLFEPGKMRFDDDLVDNSNGALETLIRVGMSIGHSPTQSQWTPDMRKNEQDITEADKQEA
KRRIQGSAALEEESPGGSGDENRGTKRTSLPPTVNTMAASAL
Download sequence
Identical sequences jgi|Triha1|2481|gm1.2481_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]