SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|3509|gm1.3509_g from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|3509|gm1.3509_g
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily EF-hand 2.08e-31
Family Calmodulin-like 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|3509|gm1.3509_g
Sequence length 147
Sequence
MASNQFDSQASTNYKEAFALFDKRGNGRCAVDSLGDLLRACGQNPTLAEIQELEKGLGGE
FDFETFQRILNRPGGFRDPGEPEEYCRGFQVFDKDMTGFIGVGQLKYILTNLGEKMTEEE
VDELLKAVDTSSGQINYTDLVRTILAN
Download sequence
Identical sequences jgi|Triha1|3509|gm1.3509_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]