SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|355870|CE186021_4631 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|355870|CE186021_4631
Domain Number 1 Region: 33-115
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 8.05e-21
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|355870|CE186021_4631
Sequence length 117
Sequence
MADPKIQELLTKSRSELTEYEIAQLEEYEFSSGPLSILQTAVRSHTQVLISIRSNRKLLA
RVKAFDRHCNMVLENVKEMWTETPRLADGKKGRPVNKDRFISKMFLRGDSVILVLLS
Download sequence
Identical sequences A0A024S7I5 A0A0F9XL37 A0A1T3C8J9 A0A2H2ZNL8 G0RME2 G9MHI6
jgi|Triha1|355870|CE186021_4631 jgi|Trire2|4479|fgenesh1_pm.C_scaffold_12000157 jgi|Trive1|35950|e_gw1.5.928.1 51453.JGI4479 XP_006966204.1.9351 XP_013960388.1.71794 jgi|Trilo1|64957|fgenesh1_pm.4_#_230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]