SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|3693|gm1.3693_g from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|3693|gm1.3693_g
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 8.56e-19
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|3693|gm1.3693_g
Sequence length 99
Sequence
MATLGGYLNKKVLIVTADSRILVGELAACDQSTNLVLKNAVERIIRTPDDPEPSAEVPLG
LYLVRGDNVCSVGLVDETLDESIDWTQVKGTVIGGIKHI
Download sequence
Identical sequences A0A0F9WZ27 A0A1T3CME4
jgi|Triha1|3693|gm1.3693_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]