SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|437518|CE267669_30105 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|437518|CE267669_30105
Domain Number 1 Region: 7-93
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 9.06e-17
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|437518|CE267669_30105
Sequence length 105
Sequence
MDKDEAHEYISSLLNQSLRVYTTDGRMFRGTFKCTDPDRNIVLGNTHEYRQPSEEERSAA
AANASGSSTILDMTSRYLGLIVVPGHHIVKMEAEQFLSQMKTQSA
Download sequence
Identical sequences jgi|Triha1|437518|CE267669_30105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]