SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|490269|fgenesh1_pm.2_#_190 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|490269|fgenesh1_pm.2_#_190
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.77e-26
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|490269|fgenesh1_pm.2_#_190
Sequence length 120
Sequence
MKLVRFLMKCANETVTIELKNGTIVHGTISSVTPQMNVALRTVKMTARGQDSIALDTMNI
RGSTIRYFILPDSLPLDTLLIDDAPKPKNKARKEADRGGRGGRGGRGGRGRGRGRGRGRG
Download sequence
Identical sequences A0A0F9XID7 A0A1T3CPD0
jgi|Triha1|490269|fgenesh1_pm.2_#_190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]