SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|4929|gm1.4929_g from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|4929|gm1.4929_g
Domain Number 1 Region: 5-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.62e-28
Family G proteins 0.0025
Further Details:      
 
Domain Number 2 Region: 420-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.04e-21
Family G proteins 0.014
Further Details:      
 
Domain Number 3 Region: 170-271,313-372
Classification Level Classification E-value
Superfamily EF-hand 5.43e-20
Family EF-hand modules in multidomain proteins 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|4929|gm1.4929_g
Sequence length 628
Sequence
MPTAVKICVCGDESTGKSSLIASLVKDQFMTNKIQPVLPQITIPPSIGTPENVTTTIVDT
SARPQDRTTLRKEVRKCNVILLVYADHYSYERVALFWMPYFRSLGVNVPVVLCANKSDLV
GQSSTSQVVEEEMLPVMAEFREIDSCIRTSAREHRNVNEVFFLCQKAVTHPIAPLFDYKE
GHLKPSCVEALKRIFFLCDKNQDGYLDNNEMRDFQSRCFDKPLTDDDLENIKLSISKSLR
GDVDLSKGINLKGFLQLNKMYAEKGRHETIWIILRKYHHTDSLSLEENFLHPKFEVPEFC
SAELSPAGYRFFVDLFLLFDKDNDGGLNDEELEALFAPTPGLPSSWADSFPSSTVRNEGG
YITLQGWLAQWSMTTFLEPKTTLEYLAYLGFEPPNPKEPITSALKVTKPRKRRRRPGRVE
RNVFHCYILGASGAGKSSLLDAFLNRPFDDLYHPTIKPRRAVNSVELPGGKQVYLIFEEL
GELEPAILENQAKLDACDLLCYTYDSSDPDSFSHIVDIRKKHPQLDELPSVYTALKADRD
KTMQRSELQPDQYTSSLNMSSPLHVSVTWNSISELFVSLAEAAANPSTAFPKTDDDSPDR
TSLYLTLGATACAAIAAVMIWRRSTNAM
Download sequence
Identical sequences A0A1T3C5N2
jgi|Triha1|4929|gm1.4929_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]