SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|493025|fgenesh1_pm.4_#_366 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|493025|fgenesh1_pm.4_#_366
Domain Number 1 Region: 277-383
Classification Level Classification E-value
Superfamily EF-hand 1.27e-26
Family Eps15 homology domain (EH domain) 0.001
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily EF-hand 3.69e-17
Family Eps15 homology domain (EH domain) 0.0056
Further Details:      
 
Domain Number 3 Region: 129-229
Classification Level Classification E-value
Superfamily EF-hand 9.72e-17
Family Eps15 homology domain (EH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 1210-1263
Classification Level Classification E-value
Superfamily UBA-like 0.00000000142
Family UBA domain 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Triha1|493025|fgenesh1_pm.4_#_366
Domain Number - Region: 520-606
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000209
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|493025|fgenesh1_pm.4_#_366
Sequence length 1264
Sequence
MSAAADPSAPNLNLSPEEKRIYGQLFRQADTDGVGVVTGEIAVKFFEKTRLDSRILGEIW
QIADKENRGFLTPAGFGIVLRLIGHAQAGREPTPELALQQGPIPRFEGIWPAAATSPSQA
QTPIQPQVSGGVRVPPLTPDKVAQYAALFERQNLQANMLPGDQARSIFDKSGLPNETLGR
IWGLADTEQRGALALPEFIIAMHLLTSMKTGALRALPNVLPAGLYEAATRSSAAAPRQSP
SNTGGITAIPRQLSGSTQQQRTGSPLNRPPIVAAQVTGPPAPTGGEWAITPADKARFDQI
YLDFDKTNKGYITGEEAVPFLSQSNLPEDTLAQIWDLADFGSQGRLTRDGFAVAMYLIRQ
QRSNRATPLPSTLPTALVPPHLRTQSRPATAVSSAFDPAPALTQTAPLPPVAASAPPAPK
SALEDLFGLDSSTPSPAPPAPAQTTMSTGGSNADPFAGGISVLHTASSPGKPSSPVGVAF
RPFVPSSSFGRGLAGHPGAEAARPHTASEDLLGDTDPEANKNISDETTELANLSNQIGSL
TKQTQEVQTKRATTQHELSQTNSQKQNFEQRLAQLRQQYEKEAQDTHALEEKLRNSRADT
KKLQGDCMNLEGQLRDIQGQHQQVLAALQADQQENANLRERIRQANAEIAELKPQVEKLK
LDARQQKGLVAINKKQLSTTEGERDKLKAEAESLAKSAEDISRQIETGSPVSTSAQMASP
ALSTSSGNNPFFKRSASTDIMGVFGPPPPNRAFSDRSFDDLFGPGPVSSSGTPPPVAAFK
QQNTGQSSVSVGSFSNNSGPTPNVSRVPTLSAEPPAPPESRQLSSSFLPFPEPNESLSSS
RQVSPPTSSRAEGSASGSFPFPGGVASGAAEAKAPAAAASSEEEEKHDSASATPVPAAQG
DSSQKPAEGEALDRSGSFDNTDHAKAKADFDNAFAAFTSAKPPSSSGADKGAAAVKPHSA
FDNAFDTEFPPISELERDVSESDSERGGFDDDFAPASPENKAKEKQVALEPTLESHRPAA
EASDSNAPLSPSQDITATHESEAKSTELPSSPATITNNHATTSPTSNADDIFGSSTIPAP
AHHNPPPAAKGAFDDLDDDFEGLEDAKEGSADDDFANISRSGLDDYNPMFDSSPPASQAK
SESTAFGNESSFDFISSNSATSAPGQSTNGQQSHDWDAIFSTLDSPTTAPAQPVHSNNTG
PAKEETAESRPPAPGRALTEAGEHDDPILKNLTSMGYSRPDALAALEKYDYNLERAANFL
ASQS
Download sequence
Identical sequences jgi|Triha1|493025|fgenesh1_pm.4_#_366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]