SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|496949|fgenesh1_pm.9_#_138 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|496949|fgenesh1_pm.9_#_138
Domain Number 1 Region: 356-591
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.34e-46
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0000117
Further Details:      
 
Domain Number 2 Region: 611-772
Classification Level Classification E-value
Superfamily EF-hand 5.14e-18
Family Calmodulin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|496949|fgenesh1_pm.9_#_138
Sequence length 779
Sequence
MVQYVFTPWRDRQELFLVREQFYGSEALMQAVGGIQGGAAYSHHQQRNQDQRRGGVEGGR
DADAEDQQHREEGQGLNQGDARRTTAAAAAKNHQTSREQGNGEKHKAVGRVSMWMQRGNC
PHMVESTALLMAAVLSDEAAATGNAGASTYAVRAAYAAAFSRFVTGLLDGHQDKLRKQSM
YSIAKNIGLPATFVELRHQATHEQLPSLAKLRSAARKALVWIWDYYWKHLGEAEKAKDPC
RELILSYLREDDEAARQRIMGQLRQWDLVYLQTTIAELQKTLPGNQVFLKCLKLSKDMAA
MATEEANQPEPEGSGMPEEQEQEQGQEQEQDLDLDPDRSPEPNTGWSRYSGAWKPKPIGV
ASNNYAYLVIDDKSKDAVIIDPANPPEVAPILKDAISSGRINLTAILSDLGNDKLAIIGG
KDCEGVTRTPQHEETFKIGDISVKPVHTPCHTQDSICYYMEDSTGKAVFTGDTLFISGCG
KFFEGNGAEMHEALNNRLGALPDDTVVYPGHEYTKSNVRFTISVSQTEPIKSLQAFAENN
EVTTGKFTIGDEKKHNVFMRVQDPEIQKATGETDPVSVMSKLREMKNNFKRPPKRKTGGP
STASKPRQSKLAKEHNVTAQEEGEIKEAFSLFAEPMDGEKNGVLPINDLKSTLIALGIPP
SSPAELQEFIAILDPESDGYATYEPFFAICALKFHARDSSGSSDAHRAELAEAFQLFTNG
ADGPITLAHLRRVAAVLKEDVDEELLKDMILEANGGVGVARGVGMDEFDSVMRSAGVWR
Download sequence
Identical sequences jgi|Triha1|496949|fgenesh1_pm.9_#_138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]