SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|502993|fgenesh1_kg.1_#_893_#_Locus2082v1rpkm71.58 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|502993|fgenesh1_kg.1_#_893_#_Locus2082v1rpkm71.58
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily EF-hand 5.19e-23
Family Eps15 homology domain (EH domain) 0.0043
Further Details:      
 
Domain Number 2 Region: 128-227
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000142
Family Eps15 homology domain (EH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|502993|fgenesh1_kg.1_#_893_#_Locus2082v1rpkm71.58
Sequence length 400
Sequence
MARPVPKIEQKEIETYWNIFVDRTGGGQFLTGEQAAPVLKNSGLRDDQLEKVWDLADVDN
DGNLDFEEFCVAMRLIFDILNGEFADVPKTLPDWMIPESKAHLVQATKAITGKQPQFEQV
EDEDDTPGLKDGFEWYMKPEDKAKYEQIYQESRDMRGEVSFTSLEDLYESLDVPDTDIRS
AWNLINPSASSSINKDACLAFLHILNNRHEGFRIPRTVPASLRSSFERNQIDYQVDNQRG
GVSSRWATKADDSTATGRKAKFGDQYLTRLGRSGFKTAGTDFSTEKTEDWEEVRLKRQLQ
DLEDRMKKVEEIAERRRGGKRDSKPALVKRELDQLLDYKRRELRDLEEGKGKSAVGGNLK
SISDDLETVREQVDGLEAHLRSREQILEQLQREIEDEKRG
Download sequence
Identical sequences jgi|Triha1|502993|fgenesh1_kg.1_#_893_#_Locus2082v1rpkm71.58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]