SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|508368|fgenesh1_kg.6_#_517_#_Locus4930v1rpkm17.91 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|508368|fgenesh1_kg.6_#_517_#_Locus4930v1rpkm17.91
Domain Number 1 Region: 222-368
Classification Level Classification E-value
Superfamily EF-hand 7.69e-21
Family Calmodulin-like 0.0033
Further Details:      
 
Domain Number 2 Region: 136-205
Classification Level Classification E-value
Superfamily RING/U-box 5.42e-19
Family ZZ domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|508368|fgenesh1_kg.6_#_517_#_Locus4930v1rpkm17.91
Sequence length 890
Sequence
MWLSTPSVESLTRPRIAVALVSAIATASIGYYAYQSRINIAQEAVLPGGGLHRSNAIRRS
RRRSRGHRPSSGSSSSDVPGDENAEIADNAENQDVPAAQPVGDGETVVDANNDEWWNDPN
NYPPQQRAGHNIVSLLFRVSEDNAKRNGCVHRGCQCNSCGMVPIRGVRYRCANCADFDLC
ETCESQGVHIKTHIFYKIRIPAPPFGPRQMQPVWYTGDPDSCRRNLPRPLITKLTRETGF
ERPELEAFWEQWTFMANTEWRDDPSDLGIAMDRKTFERCLVPTGGSRHASPNLIHDRMFA
FYDDNKDDLIGFSEFLRGLSYRKRKDKLRKVFDGYDLDSDGYVDRRDFLRMFRAYYVLYK
QMHKDILDGLEDQLLASSEAQQLVASRQPLSSLFGREGRVPTADGPLSFSGKNFYPDGHV
ELEPGMEEAVVRDTSDTADRDDILTNLFAYDTDPYSRRRMPPTDDVDTNWRTVRTLTTND
VDRSYFLALMHPPATLDELPGAVAGNNEPDDNATDETSEDGTTDDKEADEDQDHDNPESS
GSQRHDSFTSIFRTDRNPTESEIRASYVSHYRQHGPRMTKRRQDLARRQLHERWKRRHFY
LDEEEGGEAPSQWEDEEDILETSGIMGESSKGASPHRTSTHSRSSSKVRFAEDTSDSESG
SNSSESYASRPGRSTSFTSQPERWAGLGIPVAEKDAGKEILYQVTQQAFNELLDIIFKQA
EDLAVQAAATKEQRIKYKAAIDAVSLADEKAETSNGSQQEDVTIYTEASPRNKTLQELLE
ESAYMLDQQEPRNAVEISIVEEILREDPAGEAAEHSSDQGESETESESEPQHETEDEYRD
PTLPQFRPNSEVPVPVSQAPSSSKRKDKEPSKEETRPASAKPSAAKKMSS
Download sequence
Identical sequences jgi|Triha1|508368|fgenesh1_kg.6_#_517_#_Locus4930v1rpkm17.91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]