SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|527768|estExt_fgenesh1_pg.C_2_t20157 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Triha1|527768|estExt_fgenesh1_pg.C_2_t20157
Domain Number - Region: 420-466
Classification Level Classification E-value
Superfamily EF-hand 0.0795
Family Calbindin D9K 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|527768|estExt_fgenesh1_pg.C_2_t20157
Sequence length 780
Sequence
MAVISKLLPVAAALLGSVNHTAAMAVRSSADRWDVSYRVQIGTRLAPVFGSSGLASNVTA
THVHKREEDHGPDCDCELHVVYVTPDSDQGRYQGGEGSSDPSGKWENAENRNGEHREEGK
HWENGDNRKNGEYRQDGEYQQDSEGEHYQQDGEYQQGSEGEQYQQDGEYQQGSEGGQYQQ
DGEYQEDGQLREGNRYQQGGDYQEDGQSRGGNRYQQGGEYQEDGQLRDGDRYQQDGEYQQ
DGDYQQDGEYQQDGEYQQDGEGEQYQQDGQYEEDGQLRDGDRYQQDGEYQQDGQLRDGGR
YRQDGEHQEYGQLPEGGRYQQDGKSRESGEYRDGEYQEDGQFRGGYQEDGESLEGGEYQE
DGEYLEDGKSLASSQNRESGQHRAHGQHGQNGQHGQSGQDGQSGQDWANGNLSENGQLLN
EDGELSEDELLRLLNDGELSEGELIRLLNDGELSEDELLRVLNRAGLLDENGQLIVNSEG
ADLLEKWPWGQTTPNQNAQGPQGPQGPEGPQGPRGSQGVKGDTGSQGPKGDQGAQGAQGV
KGDQGDQGVQGNTGAQGPQGLQGFQGPIGPIGPQGFQGNPGPQGLQGDPGAQGDVGPQGD
PGPQGDVGPIGPLGPQGDPGATGPQGDGIQGPQGDVGATGAIGPQGPIGPQGIQGIQGVP
GAAFAEYDYTGCYQAGLLAGQAFGLDNTGANIVYSKIETASIDDCAAYCATVRAPGPPTL
FMTLSTDVDGNSICACGDVLASSDVTNGCNSACTFPQNGLVAYCGGPFSALPIVSVFGAI
Download sequence
Identical sequences jgi|Triha1|527768|estExt_fgenesh1_pg.C_2_t20157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]