SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|79443|e_gw1.3.2021.1 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|79443|e_gw1.3.2021.1
Domain Number 1 Region: 534-600
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000785
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0096
Further Details:      
 
Domain Number 2 Region: 401-484
Classification Level Classification E-value
Superfamily EF-hand 0.000000798
Family Calmodulin-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|79443|e_gw1.3.2021.1
Sequence length 832
Sequence
MNRIEEHDGEAYDGKFDDQYDEKYDEKYEAPTLDTFNTLNTLAPTHDDGNGAVTPMSQRA
EANRLNDDLELLRAERMVSNQEHDQASKSRTRNRHHNPEPEDAFNQTSTEAAPEKKKNRD
AALYKLWLFISKFPRFFRYIIYLIPGAALLLAPVLLGTFKFNGTEHAVGGTGGVYIMWFG
IWLEIVWCSLWVTRMITNLIPPLFHSVARMVGSTNAHKWRDIGQRLELHTAMFLWWLAIL
ISFKPTMDGHRAPVPDGDSGNVHMHWISVVNKVIIALFVLATLNFVEKILIQWIAQSFHQ
RTYATRIENNKADIRQLVCLFEYAKSKLESTDAFWKGSVGNPSGSGLQTPMKAFHNNARH
VLGKVGHAAGRVGNDLLGRKGADNNHPRRIVAELLRNTGSAHTLARLIYRSVVREGRETV
HLEDLQAGFETVEEAEAAFSMFDKDLNGDISMDEFEAVCNEIHLEKKAIAASLKDLDSVI
QKLDKVFLFVIVVIAIIVFVAILSDSTAAGLASAGSSILGLAWMLQATAQEFLQSIIFVF
IKHPFDVGDRVTIYGNTGATLTGDDYYVTEISLLYTEFKKMQGHIVQAPNSLLNTVFILN
QRRSNGLSDVIPLEMRFGTPAHLIDDLKARMLEFVKDNKRDYQPSIITEMTGFKEVRSCT
MNMVFFHKSSFQNELLRLNRHNKFVTELMYQMVQVGIEAPLRVDPGGSREHPMYWANMPA
PPAYGSSNSDTPAQGRPRATSSIHSVPNQEPITGGFQDVFEKRREHVHMQRMASIREKER
GLQEESDAVAQASTTSALAPAMSVDSQNQSRSRFFGRARSGTRSINSHKDMV
Download sequence
Identical sequences jgi|Triha1|79443|e_gw1.3.2021.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]