SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|80893|e_gw1.4.1697.1 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Triha1|80893|e_gw1.4.1697.1
Domain Number - Region: 377-458
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00334
Family Calponin-homology domain, CH-domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|80893|e_gw1.4.1697.1
Sequence length 482
Sequence
MSAEVENRPHSPDAAPSQAIGAKTEPSRALSTTSTISQSSSNDGTSRDSLGSELSSSSRT
RRRGYMRPQGTDFAASAKSRESVMSLGSIAHLQYYFARTGLLDGKGGQLARKKQPRATLD
LAALEGTAPMIPDLSGHGFITENAVESPTGMDDMDDFYDGFLEEDPDMLPPTASTYNHRE
KVIPKPPTVAELKTELESALQDALKVLKEAKERKEGSYKASSDAPRYPNMPDENTQSWYE
LQGMNILDFVTLAIRAAKNYYTAHELPDRLDAIKSEKQIRTDLLSVMEVLKQMATRNFKG
GMRDEEIATMTTWIESVFDILKKEANIEASEQAERSSWAWMRGDWKGKELERERQFLMSM
IPDEEPLPEWTPASNDADLPTPFLEAMQNGLLLVRLHNAAVKKSRRRFGAIPTFHVNTQK
PYRSADNLRYWAKAAELRFECMISIDPLGIVYNNGPQVWLDFEAAILKWCAHVREEITNE
LV
Download sequence
Identical sequences jgi|Triha1|80893|e_gw1.4.1697.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]