SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|81593|e_gw1.4.1041.1 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|81593|e_gw1.4.1041.1
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.24e-21
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|81593|e_gw1.4.1041.1
Sequence length 90
Sequence
MSFVPVNPRPMLQDLVDKTVLVRLKWGETEYKGRLVSIDSYMNLQLSNTEEYLNDKLTGE
LGQVLIRCNNVLYIRGADQKESGGDTRMED
Download sequence
Identical sequences A0A0F9ZYT8 A0A0W7VVD6 A0A1T3CND7 G9MLQ4 G9NJZ7
XP_013947380.1.20613 XP_013958494.1.71794 XP_018663425.1.75393 jgi|Triat1|143930|estExt_Genewise1.C_120751 jgi|Triha1|81593|e_gw1.4.1041.1 jgi|Trive1|30418|e_gw1.2.1950.1 jgi|Trias1|25609|gm1.3578_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]