SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triha1|75444|e_gw1.2.2242.1 from Trichoderma harzianum CBS 226.95 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triha1|75444|e_gw1.2.2242.1
Domain Number 1 Region: 5-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-82
Family Calponin-homology domain, CH-domain 0.0000287
Further Details:      
 
Domain Number 2 Region: 248-370
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-26
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 471-601
Classification Level Classification E-value
Superfamily EF-hand 1.15e-16
Family Calmodulin-like 0.0089
Further Details:      
 
Domain Number 4 Region: 373-478
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000134
Family Spectrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triha1|75444|e_gw1.2.2242.1
Sequence length 660
Sequence
MTLSEQQRWITVQEKTFTKWLNTKIVARNLEVKDLVPDLSDGVMLIHLLECLSHESLGRY
ASRPKLRVQKFENANLSLDFIRSRGIQMTNIGAEDVVDGNRKIVLGLIWTLILRFTISDI
NEEGMSAKEGLLLWCQRKTACYDEVEVRDFSSSWNNGLAFCALLDIHRPDLIDFDTLDKS
DHRGNMQLAFDIAQEEIGIPKLLDVEDVCDVAKPDERSLMTYIAYWFHAFSQMEKVENAG
RRVEKFFNNMQGAWEMQNAYERRMRELLKNIRGQVDQWHTAKFEGTYVDAKAQAAQFSEY
KRGKKREWVAEKSELATLLGNIKTKLSTYRLRPYEPPFEVSQEVIERDWKSLTKSEMARA
QLINETIRDIKNALRKSFADKANDFAMALNTMQLAISGLDGDIEDQLHHVKKLSDNLAPL
DRYLSTIAEVDAMCEEANIEENDFTTYTYDELAYELTLVRSSVQKKLAFLENQMVARNMT
NLTPIQLEEFESVFRHFDRDASNSLQELEFSAALASLGLVFSEEEMHDYFVDTSGGKEYV
TFEQFIRFMVDVTEDQNTAEQVFQSFREVADGKPYVTEMDLRHSLVPEEVIDTLLNMMPP
HSGPDMSRDRGKAQYDYISFMEKMMGGEDADDDIPPGVLQDSTNSGDRPRRDSKVNGVHA
Download sequence
Identical sequences jgi|Triha1|75444|e_gw1.2.2242.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]