SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159041171|ref|YP_001540423.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|159041171|ref|YP_001540423.1|
Domain Number - Region: 24-67
Classification Level Classification E-value
Superfamily SirA-like 0.0628
Family SirA-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159041171|ref|YP_001540423.1|
Sequence length 88
Comment hypothetical protein Cmaq_0592 [Caldivirga maquilingensis IC-167]
Sequence
MAINITKTVKFDRNESCETGLRHPIYTIIDELKKLNHNEGIRVLVNDYDWVLVIKNTVNL
MKNFCITDNGSNTELFHELIIYKCVLNP
Download sequence
Identical sequences A8MCC7
gi|159041171|ref|YP_001540423.1| 397948.Cmaq_0592 WP_012185653.1.60673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]