SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159041348|ref|YP_001540600.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159041348|ref|YP_001540600.1|
Domain Number 1 Region: 6-75
Classification Level Classification E-value
Superfamily SirA-like 6.02e-19
Family SirA-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159041348|ref|YP_001540600.1|
Sequence length 80
Comment SirA family protein [Caldivirga maquilingensis IC-167]
Sequence
MEEDNEITVDVKGKVCPIPVLETAKAARLAKPGQVIKVIATDPAAKQDLINWARVTNNEL
LNLDESDGVITVRIRIKGKQ
Download sequence
Identical sequences A8MCV4
397948.Cmaq_0775 WP_012185829.1.60673 gi|159041348|ref|YP_001540600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]