SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159041509|ref|YP_001540761.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|159041509|ref|YP_001540761.1|
Domain Number - Region: 27-90
Classification Level Classification E-value
Superfamily SirA-like 0.068
Family SirA-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159041509|ref|YP_001540761.1|
Sequence length 96
Comment hypothetical protein Cmaq_0939 [Caldivirga maquilingensis IC-167]
Sequence
MDDVEDLKRRLIKEILASRASGRDNKIEVMDLRGIGCDALKKFLMNYQLGEHNKRYRVLL
DNYTCFTMIKRAIPLLGGKLLDFGRESTYLFIEYEK
Download sequence
Identical sequences A8MDB5
gi|159041509|ref|YP_001540761.1| WP_012185990.1.60673 397948.Cmaq_0939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]